CAZyme Information: MGYG000004859_00687

Basic Information

• Species: Collinsella sp008014645
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp008014645
• CAZyme ID: MGYG000004859_00687
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		39967.02	6.3185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004859	1758189	MAG	China	Asia

• Gene Location: Start: 1746; End: 2819 Strand: -

Full Sequence      

MDEKIRGVNLSGWFIPEPWVSPSLFAATGASSDAELHDVLGSAAYNERLRHHYETFIGEG
DFHRMSLIGLNAVRLPIPWHAFGSQGDAATFIPAIDYIDRAIEWGEKYDIKVLLDLATVP
GGQGDSNESTTTPTTPNSTADWHSSVNGRHVALEVLEKLAARYGKAESLYGIELLDSPVM
SVRKNLFTMTEGIPSHYLRNFYRDAYELVRAHMPVEKAVVFSASAHPEMWKHFMRGSRYE
NVVMDVHLYHYYDEFAQDITSPRGLSSAIARNRKVIREARSAGFPVLVGEWSGAAVMSSA
SVTPEGRAAYERVFVSNQLASFADTRGWFFQTWKTEKRNAAWDARLALGTLERAMIE

Enzyme Prediction     

No EC number prediction in MGYG000004859_00687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	331	6.7e-57	0.9271523178807947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.62e-24	2	343	15	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68982.1	6.59e-199	3	357	2	353
QIA34389.1	6.28e-197	3	357	2	353
ATP54675.1	8.92e-197	3	357	2	353
AEB06471.1	4.38e-181	1	356	1	353
QWT17456.1	9.35e-177	4	357	28	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	3.38e-41	4	291	2	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	4.72e-41	4	249	2	254	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	8.95e-30	5	336	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	3.24e-29	5	336	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.53e-29	5	336	15	368	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	1.28e-39	3	336	29	376	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	1.28e-39	3	336	29	376	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
A2RAR6	8.31e-37	5	336	42	386	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q5B5X8	9.53e-37	3	336	27	374	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
A1D4Q5	8.28e-36	5	336	42	386	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999671	0.000355	0.000008	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004859_00687.