CAZyme Information: MGYG000004860_00633

Basic Information

• Species: Levilactobacillus namurensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Levilactobacillus; Levilactobacillus namurensis
• CAZyme ID: MGYG000004860_00633
• CAZy Family: GH120
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	MGYG000004860_3|CGC4	76636.17	4.8696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004860	2610545	MAG	China	Asia

• Gene Location: Start: 163286; End: 165319 Strand: -

Full Sequence      

MKIYVDANVVRDGNGTKEAPYKQINTAAKLAQPGDEVLVFPGTYREYVNPIHGGTDDARI
TYRSVEPLKATITGAEAVKSWQPYQDNVWVARINNGVFGAWNPYTTYVMGDWYFGPVDKH
TGAVYMNDRQFYETNSLQECLEAKVYGRSWERKNSVYKWYTEQDEDKDETVIYANFQGKN
PNHENVEINVRREVFMPQETGISNITVSGFKINKAATTWAPPASYQDGMIGPHWSKNWII
EDCDIAHSRCSGISLGKYKDPVNDQYFTYKHVKSPTQMERDAVCRGQYHGWLKENIGHHI
VRRCNIHHCEQNGIVGRQGGVFSLIEDNHIHDINNMQELAGAEIAGIKMHAAIDVIIRRN
HINDCTMGIWTDWEAQGTRITQNLLDHNYAPDGTAVRIVGAMQSQDIFVEVSHGPTLIDN
NLMLSKASLRLATEGVACVHNLMLGSITSIGTNTDYPGEGKTEPRFTPYHIQHRTEVAGF
MTILHGDDRFYNNIFVQNWPVEPKDQETLVDREADDTEQVGTNGFDDYPTYDEWYAPFAR
LDGTYAKENDMNELMSAHFGHLPIWAAGNMYFNGAKAWKKETDNLVNTKDKVDFELVEDG
DQTTIKTNLFDLIGDYAEGIITTDTLGEAFEPEQRYEAPDGSDIIFNQDYFGNHRGTATI
PGPFATEEAAKAVLWNH

Enzyme Prediction     

No EC number prediction in MGYG000004860_00633.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH120	299	388	2.5e-31	0.978021978021978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.26e-06	294	388	52	137	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.25e-04	294	422	6	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd14251	PL-6	0.003	23	75	6	59	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.
pfam07602	DUF1565	0.009	15	46	9	40	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFR62202.1	0.0	1	676	1	676
QCZ44684.1	0.0	1	676	1	675
ATU70515.1	0.0	1	676	1	675
AWP45529.1	0.0	1	676	1	675
ANN47884.1	0.0	1	676	1	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	5.05e-153	1	665	1	626	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94576	7.15e-06	3	74	36	107	Uncharacterized protein YwoF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywoF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004860_00633.