CAZyme Information: MGYG000004860_02243

Basic Information

• Species: Levilactobacillus namurensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Levilactobacillus; Levilactobacillus namurensis
• CAZyme ID: MGYG000004860_02243
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000004860_30|CGC1	77654.49	6.8944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004860	2610545	MAG	China	Asia

• Gene Location: Start: 5047; End: 7071 Strand: -

Full Sequence      

MRAILSGLHHKKNLQELEFELIDVPEPFDDLMVTFLEKQTQATVTVPITRVVNSRVVRLR
IDANDLQVPNSELSEFSWELYLNIQQDATRGLIQVESEYLSDRHQLTLTSFYQLNSDANG
MALFKLHTQQPAAEFTISAINLQDNQLQITGPNRLNNQRIEHQRLVLKNESAGSFAEWPI
AKMGLHGLFSATIPLNELAANSTQELYIRSTFEGQDLDQRVVLGKSLAGQVTQTITDQHR
LVVLEKRYNNGIRIREMAAPSLPQRLGHLPSKAGSATKLLSVLMEKVNLVYMRRLFKHGH
RAYDQPTLIFESFGGRQVSDSPYAIYQLFTQLYPGFKFVWSIDRSQKKFCKQNGIPFVVR
RTAKWVRTLEKATFWISNARFPAWVKKPSYVTYIQTWHGTPLKKLGLDIENVSMPGTTTV
KYHANFVREANRWDALVSPNDYSTQIFRSAFGFNNQILKVGYPRNDELINSSPEDIVALK
QAMGIPLDKKVVLYAPTYRDNQFAEKGKYTFELPFSLDDFKQKFGDDAVLVLRMHYLISN
ALDISGYEDFVYDLSNHPSISDLYLVSDMLITDYSSVFFDYAYLKRPILFYPYDYHMYKD
ELRGFYLDYEKDLPGDIAHDESELLTMIGEKLQTPDMSHNQKFMDFYHRFCAIDDGLSSL
KVVNYVVQQIEKNG

Enzyme Prediction     

No EC number prediction in MGYG000004860_02243.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.23e-134	307	666	6	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	2.27e-95	304	666	25	384	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXV41634.1	4.31e-113	307	671	354	719
QKI07440.1	4.31e-113	307	671	354	719
QSF52070.1	8.50e-113	307	671	354	719
QJE26285.1	8.95e-113	307	672	354	720
QDW93226.1	8.95e-113	307	672	354	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	8.92e-112	307	672	354	720	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	9.57e-111	307	672	354	720	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	2.64e-110	307	672	354	720	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	1.17e-122	124	666	161	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q5HLM5	3.99e-111	307	672	354	720	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKI5	6.05e-111	304	663	30	389	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	2.38e-105	296	662	18	383	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P27621	1.86e-32	394	666	122	376	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004860_02243.