CAZyme Information: MGYG000004861_00884

Basic Information

• Species: Limosilactobacillus sp012843675
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus sp012843675
• CAZyme ID: MGYG000004861_00884
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000004861_9|CGC1	76561.5	6.7264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004861	2071723	MAG	China	Asia

• Gene Location: Start: 47883; End: 49856 Strand: -

Full Sequence      

MLSEKDLSASLQAFSDGSNYRAQDILGVHHEKRPEGEGFVFRVWAPHAQQVWLVGDFNGW
DEHSLPMQKDRFGIWSLFTSEAKAGQLYKFNVKQSTGREIMKIDPFAVCFERRPGVAARI
IDFPDRKWKDGLWRGRQKREHHFNRPLNIYEVHAGSWRFHEDGTPYDFSDLTRELIPYLK
KMHYSHVEFMPLMEHPLPASWGYQIIGFYALCSSYGTPEQFQEFVESCHQANIGVIVDWV
PGHFNINDDALAYYDGTPTFEYEDNDRAKNIGWGALNFDLGKPQVQSFLISSALFWLNAY
HVDGIRADAISSIIYLDYDFGPWKPNKYGDTRNLEGYDFLHKATRAIKLEHPESLWIAEE
SSAGVQVTGRIEDGALGFDYKWNMGWMNDTLDFYSEDPIYRSYDFHKLTFSFMYRLAENF
ILPLSHDEVVHGKRSLMNKMWGDRYKQFAQLRNLYVWQMTHPGKKLLFMGGEFGQYLEWK
FDAPLEWVDLDDPLNQTMQHFTATLNGLYHDNPSLWELDTKDEGLEIIDADNKDQTVLSY
IRHGKRKHDFLIVILNYTPVERRNFKIGVPYPGTYQEILNTEMKEFGGTWTKHNPDCHTK
PDSFKEYEYTIETTVPSLGALILKPGKDVKIARRKPKPRKKAQKKPTNQKHKQAGSK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	177	475	7.2e-133	0.9966777408637874
CBM48	26	108	2.1e-18	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	1	630	6	632	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	14	625	14	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	11	626	608	1223	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	11	642	12	639	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	1	628	99	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI94452.1	0.0	1	657	1	657
QOL69601.1	0.0	1	657	1	655
AJT50360.1	0.0	1	657	1	655
QXL49060.1	0.0	4	634	11	640
ATP36875.1	0.0	4	634	11	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JOY_A	4.65e-181	2	625	4	618	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
5GQW_A	1.18e-168	14	624	137	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	3.33e-168	14	624	137	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	4.70e-168	14	624	137	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	6.64e-168	14	624	137	772	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1WSM8	0.0	4	634	11	640	1,4-alpha-glucan branching enzyme GlgB OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=glgB PE=3 SV=1
A8AYH3	3.24e-297	6	630	2	625	1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=glgB PE=3 SV=1
Q8DT52	8.42e-294	10	624	6	621	1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=glgB PE=3 SV=1
A3CM01	4.56e-293	6	624	2	619	1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=glgB PE=3 SV=1
Q5FL68	1.14e-291	1	634	1	630	1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004861_00884.