CAZyme Information: MGYG000004864_00496

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004864_00496
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000004864_7|CGC1	41566.76	7.4031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004864	2825139	MAG	China	Asia

• Gene Location: Start: 60076; End: 61248 Strand: -

Full Sequence      

MGERGNRLNRFLDRWAGIPLTFCTAGLRAAAGTASLNMPSEPQRVGFICLGAIGDLLLFS
SLIAAVRQRLPRARLYLLTSRGNAATASLIPGIDESVSFGVRQVPAMLDWLRGKKLDVLF
DGSQWPRLGAVLSNLSGAPCTVGFDTPGQFRACGYSHRVPHRADRHEVENFLALGRAVYA
DLEGDPCLALPAEAPADAVKADKMLVELAEARLPRVYLHMWPSGIHSRLKEWPSGHWAAL
ARELAGRGFQVCLTGAPGDAARNAAFLVDHAECPAVSLAGDLSLAGLAWMFSGAAGVVAV
NTGTMHLAALAGAPTVGLHGPTNPLRWGPRGRSVQSLLPHSGACAYLNLGFEYPDPPVTC
LENLPVDDVLDALERMGLRERAFAANDFPA

Enzyme Prediction     

No EC number prediction in MGYG000004864_00496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	109	333	1.1e-40	0.8533333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	8.91e-43	47	375	4	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.00e-41	42	375	1	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	8.16e-25	130	343	26	233	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	5.97e-13	230	376	189	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10964	PRK10964	2.53e-11	230	374	192	317	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SPD36129.1	5.54e-249	1	386	1	386
ATD80622.1	1.26e-248	1	386	23	408
QCC86285.1	2.93e-163	1	378	1	379
QTO40987.1	2.39e-162	1	378	1	379
BAD99045.1	8.02e-108	1	378	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	5.05e-08	43	324	1	284	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	5.05e-08	43	324	1	284	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	5.23e-08	43	324	1	284	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	8.49e-07	43	324	1	284	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P37421	9.39e-06	230	324	195	292	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997858	0.002175	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
44	66