CAZyme Information: MGYG000004864_00932

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004864_00932
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		42914.08	9.064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004864	2825139	MAG	China	Asia

• Gene Location: Start: 13656; End: 14867 Strand: -

Full Sequence      

MTEKLTGKAYFATFRAVSLVCCLACCMLVVACGGAHTQPVSESENTGPAQGAGPVKVAGH
ALPATGEAATGRSGGEDASPVRDGRQTPEKAPGRQPLPEGSAPAVAPVWQPLVTRLAADG
LSGPRVNALLATLAPVPSQSPMGRKMVELYKSRFMPRPPSAKPTPTTYYKGVVTEQNAAL
CRAFIAEHRQAFSQAQTRYGVPSSVAAALLFVETRLGKVLADVPENALYTLASMAVSREP
SEIDQWLPRMPGYEEHMDWLQETMPKRADWAYKEVRALVGHILQDDLDPRYLPSSIYGAV
GLCQFMPSNIAAYGADGDGDGKVDLFHVPDAVASLSNYLARHGWKSGMGKAQQHKVLMTY
NRSTVYANTILALADLVQKGAATPAKGTVRGKTEKNAAPGKGR

Enzyme Prediction     

No EC number prediction in MGYG000004864_00932.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	114	349	3.5e-45	0.6610169491525424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	1.24e-55	109	380	6	237	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02283	MltB_2	2.33e-32	154	356	40	214	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	1.49e-27	150	347	71	244	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	4.50e-25	290	375	20	107	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10760	PRK10760	2.13e-21	153	347	93	266	murein hydrolase B; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD81641.1	4.77e-229	1	401	1	401
SPD34368.1	4.77e-229	1	401	1	401
VZH34730.1	1.33e-181	7	402	7	405
QCC86237.1	5.84e-149	15	384	14	400
AMD89133.1	2.33e-148	104	377	113	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O8X_A	2.92e-16	184	347	72	208	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	3.52e-16	184	347	89	225	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	1.54e-15	168	347	76	227	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	1.57e-15	168	347	78	229	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5ANZ_A	2.44e-11	168	347	99	250	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	1.20e-14	168	347	117	268	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000120	0.008899	0.990991	0.000018	0.000006	0.000002

TMHMM  Annotations     

start	end
13	35