CAZyme Information: MGYG000004864_01669

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004864_01669
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		46014.21	8.1936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004864	2825139	MAG	China	Asia

• Gene Location: Start: 18853; End: 20118 Strand: +

Full Sequence      

MTAFLVLQAARFGDVVQTGRLLQGLAARGQVHLAVDESLVSLARLLYPFARIYGLRLHGC
DEDGILHTNVRVLEQWRHEHFSAVYNCNFSGLTAALCRIFAPELVQGFRPAPGGIWRSPW
ARMAFRLSERRVLSPLNLVDFWAFFAPDPLPPQQVNPVATPGGQGLGVVLAGRESRRSLP
MPLLAEVVRTAFSALGGPRVLLFGTAAEQPAARKLLRLLPAKMQDRVEDLSGKTSWPGLV
DAVQGLDAIIAPDTGTMHLAARLGVPVLAFFLSSALAHETGPYGHGHLVWQASRTCAPCL
ETAPCPYDVACLEPFRSQELLRSLTLALTGDARRAALPGGLQLWRSRVDSLGTVLCLESG
EDPHAARRMQVREHLASFLRLPRPCPASVPSPVMSGRAGDEEIDQWLCGDADWMLPPQRY
R

Enzyme Prediction     

No EC number prediction in MGYG000004864_01669.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	307	3.6e-30	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.59e-31	5	308	3	258	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.82e-17	5	314	5	319	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	7.45e-12	197	308	137	244	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	1.32e-06	197	271	213	287	ADP-heptose--LPS heptosyltransferase RfaF.
TIGR02193	heptsyl_trn_I	0.004	200	284	215	292	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SPD36545.1	4.27e-267	1	421	1	429
ATD80976.1	4.27e-267	1	421	1	429
VZH32283.1	3.32e-219	1	420	1	424
QCC85925.1	4.30e-187	1	420	1	426
QTO39339.1	3.27e-186	1	420	1	424

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	8.16e-07	197	271	213	287	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004864_01669.