CAZyme Information: MGYG000004868_00876

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004868_00876
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		25773.3	5.8888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004868	1640537	MAG	Spain	Europe

• Gene Location: Start: 2893; End: 3570 Strand: -

Full Sequence      

MFREDFLWGGALAANPCEGGRNEGGRGLANSDMLPFGDQRMDVMRGDLDPRALAPDSFYP
ARKGIDFYHRYKQDIELFAQMGFKCLRLSIAWSRIFPKGDEAEPNEEGLAFYEDVFRTCR
AHAIEPLVTLNLYDVPMHLVDAYGGWRDRRLVDLFERYSRTVFERYRGLVNYWLTFNEIN
IMTQACFMAAGIIFEQGENRYATVHTAVHHVLVASARAVGACHEL

Enzyme Prediction     

No EC number prediction in MGYG000004868_00876.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	224	4.9e-69	0.4731934731934732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	1.71e-100	2	225	4	227	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	4.05e-98	2	225	6	229	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	7.06e-84	1	225	3	213	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	7.81e-82	2	225	4	228	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.32e-66	4	225	8	230	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70518.1	6.10e-162	1	225	2	226
QIA34816.1	8.65e-162	1	225	2	226
AZP04102.1	1.81e-96	2	225	3	226
QTJ41013.1	3.43e-96	2	225	3	226
QTJ37616.1	3.43e-96	2	225	3	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	8.99e-76	2	225	8	222	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F79_A	1.80e-71	4	225	9	231	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4F66_A	1.80e-71	4	225	9	231	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
3QOM_A	5.17e-71	2	225	11	235	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
3PN8_A	2.20e-69	4	225	9	231	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	4.02e-87	1	225	3	227	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	3.53e-78	2	225	8	222	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P11988	3.14e-73	2	225	4	216	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	5.94e-69	2	225	5	217	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q46130	2.85e-68	2	225	7	221	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004868_00876.