CAZyme Information: MGYG000004869_00521

Basic Information

• Species: Lactonifactor sp009677585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor sp009677585
• CAZyme ID: MGYG000004869_00521
• CAZy Family: CE14
• CAZyme Description: N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		26760.55	5.1283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004869	4923116	Isolate	United States	North America

• Gene Location: Start: 98490; End: 99194 Strand: -

Full Sequence      

MRVLAIAAHPDDIEISCAGTLARYKKMGWDVFMCHVSNGNQGHAVIMPDELRAIRRKEFL
NSAALLGAEGLTCDIDDLCIYGDMREHREKVMDIIRYARPDVIITHSPNDYMPDHVAVSK
LVFDASFVSTLPHYTTREAYYETLTPIYYMDTLAGLNFVPTEYVDITDTYEQKMEMLKQH
ESQLTWMKDHDGIDFAEFVSTCARYRGLQCGAGYAEAFTPCYAWPKVKAERYLP

Enzyme Prediction     

No EC number prediction in MGYG000004869_00521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	4	114	7.8e-23	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2120	LmbE	6.05e-36	1	220	11	225	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	1.85e-30	5	122	1	124	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH21372.1	6.41e-106	3	234	1	232
AYH39662.1	3.54e-96	1	234	1	242
QNM09796.1	3.31e-92	1	234	1	234
QNK60158.1	2.72e-89	1	234	1	236
QTH40105.1	2.56e-87	1	234	1	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXD_A	8.80e-17	1	218	4	217	Crystalstructure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus],2IXD_B Crystal structure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus]
3WE7_A	2.57e-16	2	218	37	255	CrystalStructure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_B Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_C Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],5B2E_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2F_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3]
6P2T_A	1.04e-15	3	218	26	239	BshBfrom Bacillus subtilis complexed with citrate [Bacillus subtilis subsp. subtilis str. 168],6ULL_A BshB from Bacillus subtilis complexed with a substrate analogue [Bacillus subtilis subsp. subtilis str. 168]
1UAN_A	7.77e-12	1	218	2	213	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]
5BMO_A	7.74e-10	2	125	17	148	LnmXprotein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus],5BMO_B LnmX protein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus],5BMO_C LnmX protein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81ST8	8.25e-18	1	218	4	217	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus anthracis OX=1392 GN=bshB1 PE=1 SV=1
Q81FP2	4.24e-16	1	218	4	217	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=bshB1 PE=1 SV=1
P42981	2.24e-15	3	218	6	219	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=bshB1 PE=1 SV=2
D1A8M1	1.67e-07	2	146	7	185	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) OX=471852 GN=mshB PE=3 SV=1
P71311	2.36e-07	3	182	19	185	Uncharacterized deacetylase YaiS OS=Escherichia coli (strain K12) OX=83333 GN=yaiS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004869_00521.