CAZyme Information: MGYG000004869_00783

Basic Information

• Species: Lactonifactor sp009677585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor sp009677585
• CAZyme ID: MGYG000004869_00783
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
974		107391.3	4.6361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004869	4923116	Isolate	United States	North America

• Gene Location: Start: 244410; End: 247334 Strand: -

Full Sequence      

MKNIRKKLLCYVLTAVMLLTAWTPAYASSQARDSLPEEEPTQDTQPDNDSRDSLSLDCQL
LLTQEDDTHQSVILEMGDSSTVMEKAVLSYQDGDGEIHTAEAEEIVENYAAFLLDLPGEG
VTRTFLSIVTTVGGQDIETGLQPEEEMNTLSIDEEQAAEIIGDTAKQTDTESLSEEELDY
VNQTVVTKEGEDGLTASDISEVLQSEAAPASMSRSALSAPKADTKAGTFTVVLDPGHGGK
DGGAEYTFSDGTKFVESQLTLKIANYVKEALAAYPEIQVYMTRTGDTYLPDLGERVAIGV
EKNADIFVSLHINSADSEKAHGVEILVPTTGRYNHDVAVDANQLATNILDNLVALGLYNR
GLKYKDSASGTKYPDGSLADYYGIIRNCMEQGLPGVIVEHAFICGAEDKKFLDSEEDLKK
LGQADAKGIAQYFNLESTSHPNKNLTKWKYINGKWYYYKDGKKLTGWQYLGSKWYYLNSS
GVMQTGWQFISGKWYYLESSGAMAEGWKKLGNTWYYLTPGNGAMVDGWQKIGSQWYYFNG
SGAMQTGWLLLDGKWYYLNSSGARAKGWITLGKTRYYLNPETGVMAVNWNLIDGKWYYFN
ASGAALTGWQKIGGKWYYLNSSGAMAEGWLKLGKTWYYLTPGNGAMKTGWYLVGNTWYYS
DSSGAMLTGWQKIGGKWYYMNSSGAMLTGWQKIGGKSYFFDNSGVWIEHPAQGWQLENGN
WYYIGANGYHTGWLLNGGKWYYMDSTGKMLTGWQTVGGKTYYLLSSGAMVSGCYYTVDGV
TYTFTQSGESLGNIDEYPGYKIMGTSSVTADQMVKYFATSKQAYPAEVLAKGGAPDIKTF
CQIFLEECQTEGVKAEVAFTQAMKETGWLQYGGDVKIEQFNFAGLGATGGGVPGLSFADV
RTGIRAQVQHLKAYASRDNLVQTCVDPRFTYVTRYSSPFVEWLGIPDNPFGGGWAAGKNY
GSSLIGMITTLKSM

Enzyme Prediction     

No EC number prediction in MGYG000004869_00783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	841	970	2.1e-17	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	8.65e-76	446	666	443	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.69e-69	484	721	442	659	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.21e-63	527	789	444	658	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	6.00e-62	484	686	485	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.77e-61	406	666	452	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASU27509.1	8.01e-142	1	974	1	1094
ANU74705.1	8.01e-142	1	974	1	1094
QQQ92252.1	8.01e-142	1	974	1	1094
QJU15240.1	3.05e-141	1	974	1	1094
QBE99413.1	3.41e-138	61	974	117	1094

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JWQ_A	5.62e-16	231	436	4	179	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
5J72_A	3.42e-14	230	429	453	633	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
4RN7_A	9.31e-14	229	434	4	183	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
5EMI_A	9.07e-13	227	432	3	177	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
4BIN_A	4.47e-12	231	433	176	393	Crystalstructure of the E. coli N-acetylmuramoyl-L-alanine amidase AmiC [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	8.82e-20	837	964	68	188	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1
Q9K0V3	2.84e-14	231	434	192	409	N-acetylmuramoyl-L-alanine amidase AmiC OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=amiC PE=1 SV=1
P36548	2.85e-12	218	434	46	277	N-acetylmuramoyl-L-alanine amidase AmiA OS=Escherichia coli (strain K12) OX=83333 GN=amiA PE=1 SV=1
Q02114	3.79e-12	230	433	321	495	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
P63884	2.63e-11	231	433	190	407	N-acetylmuramoyl-L-alanine amidase AmiC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=amiC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005457	0.960002	0.033432	0.000522	0.000288	0.000275

TMHMM  Annotations     

start	end
7	26