CAZyme Information: MGYG000004869_03550

Basic Information

• Species: Lactonifactor sp009677585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor sp009677585
• CAZyme ID: MGYG000004869_03550
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
902	MGYG000004869_49|CGC1	99845.98	4.4849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004869	4923116	Isolate	United States	North America

• Gene Location: Start: 1350; End: 4058 Strand: -

Full Sequence      

MKKRNAARWLSGVLAAAMVFGTAGSVLADTVEGAKSAEENISPYSGAGYAMDAEYEWKYF
QNGDPADGTVAKDKWGQYNGWTRKFGTNAQDSSVYNDTDWETHAGSFDTLDGTLNSESQA
YFFRGYFEVEDPSAIEGLHLTFDYKDAAIIYVNGQQLTSLNVPDVGYKTEDTGNGSHKDN
LGYGSKDGDTENIRQADVTMRDISEMLVKGQNVIAVELHKTGADSQGYFKFGHLDLHPDT
ATLPDRDAVKAVSLTIGATPSELNLTWYSLATEGGQVQFAKKSDMTGDAFPEEKAETFEA
VETLTQGKVYTSNQATVSGLEEDTEYVYRVGNNGIWSEQVYATKTKSSGDFSFIFAGDPQ
LGSSGDLDADKDGWRNTLNLIQQDPLFSEVSFIQNAGDHVEAGTSELQYDAYLANYDGSP
VYSVPFATAVGNHDYKGTAYNTHFNLPNVSQLGDCGEGNANGDYYYVYNNSLFLVINSNN
QSTAEHKEFMRNAIHLNPDTDWKFVIFHHSIYSTASHAVDNDILSRRSTLAPVFKELGID
AVLMGHDHVYTRSYMMDGLEPMVEESTDENGEPISEITDPSGIVYITANSASGSKYYEFS
SNLEGDYVAVKNQEHVPNISKIDVSEDTFRITTYRTSDKSVVDEFTIHKTTNEKPITKTW
ENDGRGWRLKLSDGTYQTNSWAEINGIWYAFDEKGYMRTGWFLDTNGAWYYLSKSGAMAT
GWVKVGGTWYYLKESGAMAAGWIEIDGTWYYLRESGAMATGWVQVGGTWYYLRESGAMAT
GWIQTGKTWYYLKDSGAMATGWLQTGGTWYYLKGSGAMATGWVQVGETWYYLRGSGAMAV
GWVQMGGTWYYLKESGAMATGWIKLGTTWYYLKGNGAMVSGQSLKINGKMYRFNQSGACV
NP

Enzyme Prediction     

No EC number prediction in MGYG000004869_03550.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	8.88e-95	681	888	445	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	6.63e-91	698	898	442	641	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.45e-80	698	901	485	684	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	3.47e-78	681	859	488	666	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	7.82e-72	655	840	439	644	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59828.1	2.08e-129	56	652	789	1367
QNL45026.1	1.21e-121	39	657	1559	2156
AZS18334.1	9.24e-33	250	634	350	783
AIQ25865.1	5.47e-28	248	606	315	701
QTH45936.1	1.17e-27	242	691	747	1244

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9C510	3.45e-06	264	587	79	386	Purple acid phosphatase 6 OS=Arabidopsis thaliana OX=3702 GN=PAP6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000267	0.999069	0.000177	0.000191	0.000162	0.000141

TMHMM  Annotations     

start	end
9	31