CAZyme Information: MGYG000004871_01146

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004871_01146
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		23389.96	5.3101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004871	2408616	MAG	Chile	South America

• Gene Location: Start: 3995; End: 4624 Strand: +

Full Sequence      

MAWQIGNEPRCFADANKEAFRKWLVESGNVIKSIDPNHLVSVGSEGRHGCENDINLWAAI
HNDDAIDYGTIHIWPYNWGWIKPETMTQDVDKACENTAAYIRDHSKVCAKPIVLEEFGFP
RDNMATEPGSATTARDRYYEYVFGLTGSDGPPKLAGVNFWGWGGSAVPKHKSWKQGDPYT
GDPAQEDQGLNSVFSADRSTIEIIRRANR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	162	5.6e-47	0.5432525951557093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3934	COG3934	9.87e-14	1	150	140	272	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
COG3934	COG3934	7.88e-13	1	200	234	454	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38974.1	2.69e-91	1	208	224	439
QCP72664.1	2.69e-91	1	208	224	439
QNT65312.1	4.47e-81	1	205	207	416
ADV42264.1	5.05e-80	1	208	211	424
QBJ17987.1	5.34e-80	1	209	212	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	2.42e-40	1	208	208	426	Exo-mannosidasefrom Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]
4LYP_A	4.40e-24	1	208	231	437	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]
4LYQ_A	2.96e-23	1	208	231	437	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E202A mutant [Rhizomucor miehei],4NRR_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRR_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRS_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei],4NRS_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei]
4LYR_A	2.96e-23	1	208	231	437	GlycosideHydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant [Rhizomucor miehei]
3PZ9_A	5.79e-21	1	160	181	340	Nativestructure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L5J1	3.31e-19	1	144	197	342	Mannan endo-1,4-beta-mannosidase 4 OS=Solanum lycopersicum OX=4081 GN=MAN4 PE=1 SV=2
Q6Z310	3.48e-19	1	143	202	347	Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN9 PE=2 SV=2
Q9M0H6	1.89e-18	1	162	207	376	Mannan endo-1,4-beta-mannosidase 5 OS=Arabidopsis thaliana OX=3702 GN=MAN5 PE=2 SV=1
Q7Y223	6.65e-18	1	162	208	377	Mannan endo-1,4-beta-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=MAN2 PE=2 SV=1
Q9SG95	2.09e-17	1	160	195	364	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004871_01146.