CAZyme Information: MGYG000004872_02245

Basic Information

• Species: Stoquefichus sp001244545
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Stoquefichus; Stoquefichus sp001244545
• CAZyme ID: MGYG000004872_02245
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000004872_12|CGC1	54904.13	4.8612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004872	3555940	MAG	Sweden	Europe

• Gene Location: Start: 28726; End: 30144 Strand: +

Full Sequence      

MKKDFLWGAALSNVQAEGGYLEDGKGLNVYDTLVVTPEKGIVPMFCDTKVATDHYHHYKE
DIDLMAEMGFKAYRFSVVWSRIHPQGDDEVPNQKGLDYYEDMVDYLLEKGIEPVVSLVHF
DMPDHLLRKYNGFLNKQVIDFYAKHVEAVVSRLQGKVKYWLTYNEINLAPYQSDLVAGAY
RPDDMSLAELFAHLSVNTAIAHARAVEVIKRIDAKAWVGGMIGHAPFYPLTCRSEDIIAA
DFKNKMHNYLPFDIMTSGQLPEYFINFVEKRNIDILFNEDEKQVVKDASEKLDYLAFSYY
RSGVQSSFDDIEDLIELEDAILFDQRGLKNPHYTANEWGWQIDAEGLRYSLIDLYDRYHK
PLFIVENGIGIDEKLVDGKVYDDERISYYQKHITSLKRAVEHDGVDLLGYLAWSPIDFLS
SHKEIRKRYGFVYINRDFDDLLDLKRYPKKSFYWYQKVIKSDGEDLENNIDY

Enzyme Prediction     

No EC number prediction in MGYG000004872_02245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	463	1.5e-131	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.62e-164	1	467	4	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	1.81e-144	1	466	4	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	1.08e-131	3	467	8	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.49e-128	1	466	6	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09852	PRK09852	1.95e-127	3	467	6	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV04539.1	2.53e-292	1	472	1	472
QQY27346.1	8.04e-289	1	472	1	472
QPS13834.1	1.14e-288	1	472	1	472
QMW75828.1	1.14e-288	1	472	1	472
QQV05702.1	1.33e-287	1	472	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.57e-123	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
2XHY_A	3.05e-123	1	466	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F79_A	4.45e-123	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
6WGD_A	1.14e-120	5	466	12	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3PN8_A	1.82e-119	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	5.75e-126	1	466	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.67e-122	1	466	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	8.85e-121	3	467	9	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	2.21e-120	5	466	12	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	5.61e-111	5	467	8	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004872_02245.