CAZyme Information: MGYG000004876_00238

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_00238
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	MGYG000004876_2|CGC2	59086.58	4.8368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 38712; End: 40319 Strand: -

Full Sequence      

MKLKNLLFLSSLLSLMACSDDSPTTPDNPETPEQPDITNSVEKLVTLDASQTYQTIAGFG
ASDCWSPSFVGKSWTSGRAGITELLFSSEIVNGKPKGIGLSQWRVNLGGGSAQQGDASGI
EDKSRRAESYLKDDLTLDWSRCEGQRYFMSRAKELGCNNFILFSNTPPIQYTYNGKGFSA
QGASSNLKTEHYDDFAGYMAKVAAHYVGEGYNVTHISPVNEPQYNWESGQEGSGWTNDQV
AELARELDASLTASGLSTDILLGESGDWEYLYKSKSDDRRSNVLNAFFKEGSSAYVGNLP
HVKNLICGHSYWTDGTWDGMRSVRKQMAQAAGQYGLEIWQSEWSMLGDGYSSSEFVGYEQ
ASEMDIAFYMSKVIHNDLTVAGVSSWSYWTSMDISRWGHKNRFLLISLVPDGGEYGDIEQ
EGTYRATPTLWVLGNYSRFIRPGYKRIALALNETRSFFGSAWISPEKDKIVAVYTNMSAR
NVRLGETHIGWSAEAKSVTTYTTTDSKNLQEATVASSSPVLLESGSVTTVVYNLK

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	45	531	2.2e-175	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.85e-127	42	393	1	357	O-Glycosyl hydrolase family 30.
COG5520	XynC	3.73e-10	44	534	35	430	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT97738.1	0.0	1	535	1	535
QUT61024.1	0.0	1	535	1	535
QQA29541.1	0.0	1	535	1	535
QUT66304.1	0.0	1	535	1	535
QUT34917.1	0.0	1	535	1	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	5.35e-70	42	531	5	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	2.10e-11	45	484	25	407	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
4FMV_A	6.85e-10	45	528	5	373	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
7O0E_A	3.31e-09	45	531	5	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	8.16e-09	45	531	12	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	3.55e-17	45	443	24	381	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	3.55e-09	45	531	29	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000105	0.039952	0.959841	0.000046	0.000046	0.000028

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004876_00238.