CAZyme Information: MGYG000004876_00380

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_00380
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000004876_2|CGC7	89895.81	8.0986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 249614; End: 251947 Strand: -

Full Sequence      

MRAKICLIITSLMLAASSIHAQSIWDKAHLEKVKQSLHQPYFSAAYQELITDAERTLDAQ
PLSVMMKEKTPGSGDKHDYMSQARYFWPDPTKPDGLPYISRDGESNPELNKLDRNRLGAT
AQRVTTLALAWYFSGDEKYARKATELIRIWFFNKDTRMNPNLEYAQMIPGHNNNKGRCYG
VIDTYSFVEMLDAVQLLEGSKAFTPKDSKQLKAWFGKLLTWILNSPQGQEEARQANNHST
AHDAQVIAFALYAGNMKVAQEVINAIPRKGIFTQIEPDGKQPHELRRTLAFGYSQFNLSH
FIDIFMMARKIGISIDNATSADGRNFYKAMDFLVPYVGKEVKDWPYRQISEWEYKQQEFC
KDLYRTSLLNPARKDYLALYKAHRIINWKDRFNLLWVEADDVDNAYAFACRQLLFALKCA
DKARKEGDNQCKHRVTPRSLNKDGSLRMIHPHDWCSGFFPGSLWQMYAYTNDDFWRQQAI
SNTWMIEEAKWHKGTHDLGFMMNNSFGKAYQLTGERSYKDVVLQSARTLITRYNKKVKSI
RSWDHNRDKWKFPVIIDNLMNLEMLFWATQETGDSIYWKIAVNHANTTMKNHFRPDYSSF
HVVDYDPETGEVRARQTAQGYADDSFWSRGQAWGLYGYTMCYRFTRNPAYLQQARHIADF
FFGLPNLPEDLIPYWDMKVPGIPNVPRDASAGAIMASALYELRGYVSAEDGKRYQDIADK
IVDSLNQHYRAEPETTYGFLLLHSTGHHPGGDEIDVPINYADYYYLEALARKAALEQ

Enzyme Prediction     

No EC number prediction in MGYG000004876_00380.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	451	771	1.2e-130	0.9787234042553191
PL38	64	340	4.4e-109	0.985663082437276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	2.97e-93	63	340	1	271	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam07470	Glyco_hydro_88	1.65e-12	433	771	3	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59781.1	0.0	1	777	1	777
QUT89187.1	0.0	1	777	1	777
QDO68113.1	0.0	1	777	1	777
QUT65853.1	0.0	1	776	1	785
QUU01289.1	0.0	1	776	1	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.98e-122	24	396	8	379	Crystalstructure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]
3WIW_A	4.07e-102	435	777	54	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	8.77e-51	397	771	6	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	8.98e-51	397	771	7	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	3.20e-50	397	771	7	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	3.03e-109	437	775	59	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	8.86e-55	437	771	50	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	8.00e-52	437	771	53	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	4.92e-50	397	771	7	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	7.09e-49	435	771	12	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999057	0.000205	0.000160	0.000156	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004876_00380.