CAZyme Information: MGYG000004876_01358

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_01358
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000004876_12|CGC1	41405.76	8.8748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 34996; End: 36078 Strand: +

Full Sequence      

MKQVAIVGIQGVPAKYGGFETLVENIIGDNCCSEICYTVFCSGKDYATRMKSYKGARLKY
VPLFHANGIQSTPYDILSMLKCLRGYDAVVILGVSGCIFLPIFRLLYRKHLIVNIDGLEH
RRAKWGKFAKWFLRTSEAMAVRYADVIIADNKGIQNYVWNTYQKKAELVAYGGDHAQRDV
TEERQNEILKRYGITPGCYAVSVCRIEPENNCHLILKAFATSGENLVFVGNWERSEYSRR
LKEEYHGRQNIQMPDSVYDLDVLYALRNQCRCYIHGHSAGGTNPSLVEAMFFGKPILAYD
VIYNRETTENKAHYFKTSEELVELLHSRPKDGCKMQEIATKRYTWSFIAWKYRMLILSHK

Enzyme Prediction     

No EC number prediction in MGYG000004876_01358.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04955	GT4-like	2.00e-72	4	357	2	379	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.
pfam09314	DUF1972	1.88e-25	1	174	1	186	Domain of unknown function (DUF1972). Members of this family of functionally uncharacterized domains are found in bacterial glycosyltransferases and rhamnosyltransferases.
COG0438	RfaB	2.52e-13	13	349	11	367	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd01635	Glycosyltransferase_GTB-type	2.04e-12	188	309	101	227	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00534	Glycos_transf_1	2.31e-12	199	325	4	138	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90191.1	3.34e-245	1	360	1	360
ALJ58702.1	5.52e-244	1	360	1	360
QUU04030.1	1.15e-194	1	355	1	357
QCD41036.1	1.05e-161	3	352	2	350
ANU57855.1	4.55e-151	1	355	1	354

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
88	107