CAZyme Information: MGYG000004876_01636

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004876_01636
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	MGYG000004876_16|CGC1	33239.92	4.405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004876	4781463	MAG	China	Asia

• Gene Location: Start: 42303; End: 43202 Strand: -

Full Sequence      

MNLKFKYIIVAGLLVGMTGCDDKLETFEVAGSVTTPTALAASVVSSEALPGQIKLSWEAP
AENAFDYLQIKYYDPLTKEDVCKIASVGTTEMLIDDTRARFGDYSFYFQTFNAAHQGSAV
TEVKAKSGEAPATTTEKSRTEVKLAGDQLSTNAQEPTEGPIKNLVDGNSGTFFHTRWSSP
QLELPHYIQIDFKESHENFAIYYQNRTDNTWTSDGRPSVVELQISNDAKNWETVGTLSGL
PSAHSTEYTSDFVMPGKTFTYFRFNVTATSGNTKYFNLAEFKFYDVEIEVYDPETVPLD

Enzyme Prediction     

No EC number prediction in MGYG000004876_01636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	151	282	7.1e-18	0.9193548387096774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	5.52e-15	148	281	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	7.53e-05	163	234	27	92	Substituted updates: Jan 31, 2002
pfam17132	Glyco_hydro_106	0.001	148	284	175	314	alpha-L-rhamnosidase.
cd08366	APC10	0.009	160	237	19	89	APC10 subunit of the anaphase-promoting complex (APC) that mediates substrate ubiquitination. This model represents the single domain protein APC10, a subunit of the anaphase-promoting complex (APC), which is a multi-subunit E3 ubiquitin ligase. E3 ubiquitin ligases mediate substrate ubiquitination (or ubiquitylation), a vital component of the ubiquitin-26S proteasome pathway for selective proteolytic degradation. The APC (also known as the cyclosome), is a cell cycle-regulated E3 ubiquitin ligase that controls important transitions in mitosis and the G1 phase by ubiquitinating regulatory proteins, thereby targeting them for degradation. In mitosis, the APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin and triggers exit from mitosis by ubiquitinating cyclin B. The C-terminus of APC10 binds to CDC27/APC3, an APC subunit that contains multiple tetratrico peptide repeats. APC10 domains are homologous to the DOC1 domains present in the HECT (Homologous to the E6-AP Carboxyl Terminus) E3 ubiquitin ligase protein, and the Cullin-RING (Really Interesting New Gene) E3 ubiquitin ligase complex. The APC10/DOC1 domain forms a beta-sandwich structure that is related in architecture to the galactose-binding domain-like fold; their sequences are quite dissimilar, however, and are not included here.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89968.1	2.47e-182	1	299	1	299
QRP56724.1	1.37e-120	1	299	1	297
QQT78032.1	1.37e-120	1	299	1	297
QUU07363.1	1.37e-120	1	299	1	297
ALK86788.1	1.18e-116	1	299	1	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2J7M_A	9.45e-07	151	236	14	99	Characterizationof a Family 32 CBM [Clostridium perfringens]
2J1A_A	9.61e-07	151	236	15	100	Structureof CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in complex with galactose [Clostridium perfringens ATCC 13124],2J1E_A High Resolution Crystal Structure of CBM32 from a N-acetyl-beta- hexosaminidase in complex with lacNAc [Clostridium perfringens ATCC 13124]
2V5D_A	6.06e-06	151	236	602	687	Structureof a Family 84 Glycoside Hydrolase and a Family 32 Carbohydrate-Binding Module in Tandem from Clostridium perfringens. [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004876_01636.