CAZyme Information: MGYG000004877_01679

Basic Information

• Species: Olsenella sp900555995
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp900555995
• CAZyme ID: MGYG000004877_01679
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205		22206.93	8.1227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004877	2221712	MAG	China	Asia

• Gene Location: Start: 239; End: 856 Strand: +

Full Sequence      

MDAFTRFRSFEDCIRFRSRVLLQAERYAGNEKIRRAIEGRDSDLMAEGLKDAGYATSSSY
VDSLKAAMDAYSLRRFDSMSADELREAGSAGAASGKGATIVAAAQSQLGTPYVWGGSTPY
KALDCSGLTQWCYAQAGIRIPHQSEAQMRAGTRVPLSQAEPGDILWRPGHVAIYVGGDSY
IHAPQPGDHVRVGTGIGRFTCAVRF

Enzyme Prediction     

No EC number prediction in MGYG000004877_01679.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	4.30e-25	109	192	1	88	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.67e-24	92	192	70	179	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	7.52e-23	86	199	355	474	invasion associated endopeptidase.
NF033742	NlpC_p60_RipB	2.20e-21	86	192	57	188	NlpC/P60 family peptidoglycan endopeptidase RipB.
NF033741	NlpC_p60_RipA	1.03e-17	104	192	335	439	NlpC/P60 family peptidoglycan endopeptidase RipA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR72935.1	3.99e-128	1	204	372	575
SDR79947.1	4.98e-107	3	205	378	577
ACV22911.1	3.16e-85	1	205	357	555
VEH01716.1	3.16e-85	1	205	357	555
CBL05228.1	4.37e-81	2	205	260	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	9.32e-24	97	194	28	130	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
4HPE_A	1.06e-16	109	186	199	285	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
3PBC_A	1.11e-14	100	192	88	196	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3NE0_A	1.11e-14	100	192	88	196	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
2XIV_A	1.42e-14	100	192	83	191	Structureof Rv1477, hypothetical invasion protein of Mycobacterium tuberculosis [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	1.51e-20	97	194	402	504	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
P9WHU2	3.44e-18	93	192	269	370	Probable endopeptidase MT2245 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2245 PE=3 SV=1
P67474	3.44e-18	93	192	269	370	Probable endopeptidase Mb2213c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2213C PE=3 SV=1
P9WHU3	3.44e-18	93	192	269	370	Probable endopeptidase Rv2190c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2190c PE=3 SV=1
Q8NNK6	2.01e-16	87	183	88	186	Probable endopeptidase Cgl2188 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl2188 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004877_01679.