CAZyme Information: MGYG000004878_02777

Basic Information

• Species: Butyricimonas sp900184685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp900184685
• CAZyme ID: MGYG000004878_02777
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668	MGYG000004878_336|CGC1	76855.82	6.7188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004878	4513844	MAG	China	Asia

• Gene Location: Start: 2846; End: 4852 Strand: -

Full Sequence      

MPVSEDDNFFISRVKLKERFENVKTQVHPELSMERQLCWWTPMGDGKKQWKSFPRNQFEA
DNFSMWQYVDIHGNWGDGWFRVPGVFNDAAHKNGVRTGCVLFINWGESVRKPGDRVYDLF
AKLTEKDEYGRFRYAERLILFLKYYGIDGIGINPEGVWSADIASEVQDFFAELHVQAKVQ
GLKGFHIDWYDSNDNNGRLSFGQNALQNRNRDWFQKGNRVVSNMFMLNYNIDNWGGNKDP
MGESARNAVAYGRSSYDVYAGFYLRGRGLSSYDFEPREGKGWEVLKDKPVSVCLWGEHER
NNIHNASREYGEDSLTVQETYLRKLEYFFTGGTRNPVNAPAVTNTITTVNEKDMQRFHGI
STFFPARSAIRELPFVTRFNLGNGFFFNKEGKTVNTLAWYNIGMQDWMPSWRWWVTGRDE
CVSEDAVRCDFVFEDAWFGGSCLKLHGATGYSKVRLFKTDIPVDGHVELAFTCKVERSDD
SHLKVILSRVGTEAEFIEIPVRQEVKPGQWQTIRCKLGDYGIQAGERIACIGLVVENTPE
DYEAFIGELSLIDPRVKYNPVRPDILATKVIREYNDSLDFKLVWDVIPLVNREKDMPVMN
EAVDTWYYEVYVRESPRGKARLVATTTSWAAYVCGVPVLPGGKGLWLGVRAVAPDGKRTS
KITWERVK

Enzyme Prediction     

No EC number prediction in MGYG000004878_02777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	54	387	1.2e-61	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	3.73e-64	5	553	48	551	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
cd06547	GH85_ENGase	9.83e-48	56	419	20	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam03644	Glyco_hydro_85	3.90e-40	56	384	3	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77741.1	5.97e-192	2	664	57	714
AHF12130.1	9.68e-176	3	664	67	709
BCI64756.1	5.33e-174	6	664	70	734
EFC71170.1	2.96e-167	6	664	57	703
EFC71169.1	9.02e-163	6	664	57	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VTF_A	7.61e-50	58	622	81	602	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
3FHA_A	1.33e-49	58	636	76	586	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.33e-49	58	636	76	586	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2W91_A	2.16e-33	57	663	79	629	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	4.88e-33	57	663	230	780	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004878_02777.