CAZyme Information: MGYG000004878_03064

Basic Information

• Species: Butyricimonas sp900184685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp900184685
• CAZyme ID: MGYG000004878_03064
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		53858.82	9.1317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004878	4513844	MAG	China	Asia

• Gene Location: Start: 197; End: 1636 Strand: +

Full Sequence      

MKKCVFVFLIMILVVYGYAQTVTSTKTLTDSLRVQFEKDAKQITSDFEAYSKQAREEYAK
YEAQAKADYFRYVRSIKKVWGEDSVIDNTRTEWVEYSDDYHSRSIVDFDKGEIFVEIALD
DIGVTDSTEINARLAEAIERMLNSRGSTCPYQSSVDASEALTQKPILDGLVDFSKYKFDT
SSASTDRKPTSARPVPPVPTVKGKNLTVDRKQDSLARTVDTGKTMAQRTLEKDDKRNGNP
LASKQEEARERAEQKKQEWSGKGETASIAKAIAAQSKKTVKVTGTNKEARQVVQVQMSLV
ADNLSKNAALYKDLVAEFSRVYQIEASLIYAVMEQESCFNPEATSWVPAYGLMQLVPTSG
GFDAFRYVYKREWIPTRSYLFNPRNNIELGTAYLRVLSNQFASVANSDCRKLCVIAGYNT
GAGNVSRAFTGATNLNKAIPLINECNYEQLYSHLTTRLSTSEARNYVSGVTKRQKKYLK

Enzyme Prediction     

No EC number prediction in MGYG000004878_03064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	326	475	3.5e-20	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	7.73e-68	313	475	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	2.58e-48	290	477	171	356	membrane-bound lytic murein transglycosylase MltC.
cd13401	Slt70-like	1.68e-26	311	427	6	113	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.94e-24	311	476	4	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.79e-23	322	439	8	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ42243.1	3.16e-42	88	477	72	383
BBN58488.1	3.67e-42	73	479	83	394
ALA57832.1	6.96e-42	75	478	87	403
QOY55592.1	1.36e-41	272	479	177	391
AEG32436.1	1.47e-41	311	478	217	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.98e-30	290	477	153	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	5.14e-30	290	477	153	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	8.08e-14	324	467	35	176	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	1.49e-13	324	467	35	176	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	1.77e-13	324	467	52	193	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2NRB3	9.97e-34	290	477	170	355	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1
A6TDX1	3.82e-33	286	477	168	357	Membrane-bound lytic murein transglycosylase C OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=mltC PE=3 SV=2
B5XU88	5.27e-33	286	477	168	357	Membrane-bound lytic murein transglycosylase C OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=mltC PE=3 SV=1
A7MLX9	1.00e-32	290	477	172	357	Membrane-bound lytic murein transglycosylase C OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mltC PE=3 SV=2
Q65VT8	1.30e-32	290	477	168	353	Membrane-bound lytic murein transglycosylase C OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000316	0.998963	0.000208	0.000158	0.000153	0.000148

TMHMM  Annotations     

start	end
5	22