CAZyme Information: MGYG000004879_01460

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_N
• CAZyme ID: MGYG000004879_01460
• CAZy Family: CE17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	MGYG000004879_26|CGC1	68906.17	4.9165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004879	3926800	MAG	China	Asia

• Gene Location: Start: 28228; End: 30045 Strand: -

Full Sequence      

MRGPVAPKDPEKHRPFFYIMRDKQVFGSKQKDGSGVQFIYENDGRLLCSAQIVGNITGER
ELEMLKTVKGFRQLVHSIGVSVEMPENEDPITFLFQMYGKKDLYGGGTRLSMQVEPNGAE
HRLYLADANWMADDEEPGQIRFIFQEPEKLARVNVRFYLNDGFLAPEQDGEEPIDEKAVG
YQNMIARSLLSKGNLFRMQKAIRKAEEGEDVTLAFIGGSITQGAGAIPIHTECYAYKTFQ
LFKERFTGPHSDRNEKSEESVAADEDCKTKKAGVGKNHVHLLKAGVGGTSSELGMIRFDR
DVLRNAEKPDIVVVEYAVNDEGDETHGDCYESLVRKILALPWRPAIILLFMVFADDFTLQ
ERFVPIGEKYDLPMISIRDAVTQQFHLTKEQGRVLTRNQFFYDRYHPTNAGHTIIAKCMD
NLFAAAQEMRAVGLIPVDVTEELLQQEPVIGKTFEQVKLLDRAEKYENAKIRCGGFYGTD
TDLQCVEMDDQLTMIPEFPHNWMYDGTQEKEKGEKMTEQSFRMNIRCRALLLVSKDSGEL
DAGRADVWVDHEYVLTADPHLNGWTHCNPLIILEEAESREHEIEIRMYDGDENKKFTILG
FGYVR

Enzyme Prediction     

No EC number prediction in MGYG000004879_01460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE17	277	412	1.5e-31	0.7878787878787878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00229	SGNH_hydrolase	2.79e-11	213	417	1	182	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	2.80e-10	215	414	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01834	SGNH_hydrolase_like_2	3.83e-05	213	426	4	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01827	sialate_O-acetylesterase_like1	6.17e-05	211	417	1	181	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF46877.1	4.29e-185	3	603	15	577
QYK61360.1	5.06e-184	1	604	14	579
BCN32107.1	6.89e-35	179	593	1	357
AOZ96974.1	3.61e-33	187	484	8	267
BCJ92770.1	1.21e-32	181	502	3	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HH9_A	1.16e-31	176	593	2	356	Crystalstructure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82]
6HFZ_A	2.14e-31	176	593	2	356	Crystalstructure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004879_01460.