CAZyme Information: MGYG000004880_00401

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004880_00401
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		44147.42	8.9106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004880	2890596	MAG	Spain	Europe

• Gene Location: Start: 89416; End: 90603 Strand: -

Full Sequence      

MTSAAVAAALVLGACTAQKEDKTVAPWGETACDEALSEDFDLDNIVAAGELIALTLSGPE
SYYDYRGRKLGVQYLLCQKLADRLGVSLRMEVCRDTSEMLSRLAAGDADLIAYCLSRKAL
AAGKDSLGQMIFMGDSVGGRPLGWVVGEGKDDLAAELRSWYGAKVLDGVRREEAFLLSSR
SVRRHVYSPMLNRSGGVISRYDGLFMTYCRPIRWDWRLMAAQCYQESTFDPRARSWAGAC
GLMQIMPSTAERLGLPQSKIYDPESNIAAAARYIGQLEGKFTDIKDRSERTNFVLACYNG
GYHHIRDAMALAARDGRNPHRWDEVSRYVLLLSEPRYYRDPIVKYGYMRGSETVGYVDNI
RRRWQSYRGVGGPKGGHGGFMEPRKALREKKKYKI

Enzyme Prediction     

No EC number prediction in MGYG000004880_00401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	213	365	4.2e-28	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.15e-76	205	368	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	2.07e-55	42	366	36	449	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.90e-50	37	368	11	432	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	1.60e-21	215	308	11	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	7.52e-21	225	306	30	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	4.48e-147	18	395	20	389
ADE82116.1	3.45e-143	10	395	15	375
QVJ81630.1	3.97e-142	10	395	15	375
AGB28026.1	2.91e-138	10	391	36	410
QUB48180.1	1.90e-136	12	395	16	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	2.54e-27	42	362	11	423	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	6.02e-27	140	362	195	416	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	6.50e-27	140	362	202	423	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	3.61e-26	140	362	188	409	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	3.61e-26	140	362	188	409	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47XX8	8.30e-34	30	366	18	441	Membrane-bound lytic murein transglycosylase F OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) OX=167879 GN=mltF PE=3 SV=2
A8AD27	1.22e-32	43	362	33	446	Membrane-bound lytic murein transglycosylase F OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltF PE=3 SV=1
A0KJ50	1.88e-32	42	366	40	452	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A9MGY7	8.04e-32	45	362	39	446	Membrane-bound lytic murein transglycosylase F OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=mltF PE=3 SV=1
A1JKM2	8.21e-32	38	362	32	445	Membrane-bound lytic murein transglycosylase F OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002217	0.118934	0.878647	0.000075	0.000084	0.000062

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004880_00401.