CAZyme Information: MGYG000004880_01221

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004880_01221
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743	MGYG000004880_11|CGC1	82271.4	5.9691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004880	2890596	MAG	Spain	Europe

• Gene Location: Start: 16917; End: 19148 Strand: +

Full Sequence      

MKKILISVLLAFSILPATYAQLPAYLDENLPVEQRIEDALKRMTLEEKIAVIHAQSKFSS
PGVKRLGFPDFWTDDGPHGVRPDVLWDEWEQAGQTNDSCVAFPALTCLAASWNPQMSLIY
GEALGEEALYRGKDMILGPGVNIYRTPLNGRNFEYMGEDPYLASRMVIPYIKGLQSKGVS
ACVKHYALNNDEEYRHQVNVIVSDRALHEIYLPAFKAAVTEAGTWAVMGAYNLYKDQHNC
HNDIMLNRILKHDWQFDGVVVSDWGGCHDTEEAITGGLDMEFGSWTDGLTMGATNAYDSY
YMAQPYLRLIREGKYTTKELDEKVRRILRLFYRTTMNRQRPVGFLCSEQHYATALRVAQE
GIVLLQNNGGVLPIDMAKARRVLVVGENAVKMMTVGGGSSSLKVQREISPLDGLKARLAK
AGISVDYARGYVGDTTGAYNGVTTGQNLADSRSPEELIAEAVEKAKDADYVIFFGGLNKS
DYQDCEGHDRKDYGLPYGQGRVVEALAKANRNLVYVNISGNAVAMPWQKRVPAIVQGWFI
GSEAGEALASVLAGDVNPSGKLPFTWPVDLNDVGAHRLGAYPGVWRDGNKIIDEEYKEDI
FVGYRWAEKEKIKPLFAFGHGLSYTTFKLSNVRTDKTELTADDTLAVTVTVTNTGSRAGA
EVVQLYVTDVKSSLPRPLKELKGFAKVYLEPGESRDVTLTVDRSALSYYDDRAGGWTAEP
GTFVAQVGTASDKITARKLFRLV

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	63	281	1.9e-61	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.26e-113	1	735	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	1.62e-66	1	702	3	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.40e-63	362	604	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	5.91e-57	65	402	57	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.20e-32	65	330	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66867.1	0.0	1	742	1	753
QVJ80217.1	0.0	1	742	1	747
ADE83352.1	0.0	1	742	9	755
BCS85387.1	0.0	35	734	2	701
QMI79977.1	0.0	1	742	1	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.44e-149	36	742	5	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.04e-126	43	736	12	657	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.24e-110	36	742	6	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
4I3G_A	5.07e-108	29	731	47	817	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
3ABZ_A	3.87e-107	36	742	6	836	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	6.42e-277	21	743	31	746	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	7.91e-149	36	742	5	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.31e-129	39	734	8	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.40e-127	39	734	8	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	1.28e-122	36	736	2	804	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000229	0.999113	0.000170	0.000167	0.000163	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004880_01221.