CAZyme Information: MGYG000004881_01375

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000004881_01375
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		43096.04	4.6988

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004881	2323503	MAG	China	Asia

• Gene Location: Start: 84; End: 1196 Strand: +

Full Sequence      

MKSNINYAPIEYAKLACDTMMNKFKAEELPPEKLFHYHQGVFLSGMERTYLATGEQKYSD
YIKAWVDSIVYEDGSIHEYDKTRLDDLQPGILLFRLYHETGDKRYKIVIENIADILKHWY
VNDEGGFWHKECHPNQMWLDGLYMAGPFMTMYGKEYLDSSRFDVMLTQTRLMTKHNRDNE
TGLLYHACDCSKEEDWADEKSGCSPCFWGRAMGWYAVAILDMLDYLPEDFYGRAEMLEYL
TKFLTAVEKYQDKKEGLWYQLVDKTNDPQNWFETSCSALFVYAFAKAVRKGYISEKFKDA
AVKGYNGVINKLIISDDKTVIVPDICVGTGVGDYQFYIDRPVCENDLHGMGAFVLMCTEY
DLMCREELSE

Enzyme Prediction     

No EC number prediction in MGYG000004881_01375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	30	360	5.3e-107	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.11e-108	2	360	1	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.14e-104	12	360	1	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ52128.1	2.80e-148	9	362	9	361
ANY68695.1	1.56e-147	8	362	9	362
AFH61356.1	6.52e-147	1	362	1	362
AZK46659.1	1.18e-146	9	362	10	362
AFC29184.1	1.31e-146	1	359	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	9.21e-112	8	365	12	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.79e-111	8	365	2	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	2.45e-81	11	363	3	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	3.78e-21	33	351	78	401	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.04e-111	8	365	12	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.85e-22	182	365	38	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.85e-22	182	365	38	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	8.03e-15	40	278	34	262	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	1.04e-07	126	359	187	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004881_01375.