CAZyme Information: MGYG000004881_01414

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000004881_01414
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41969.36	4.927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004881	2323503	MAG	China	Asia

• Gene Location: Start: 441; End: 1550 Strand: -

Full Sequence      

MINEELNKIHQKLLVNGKKYDSVSPSPSATDGIYPVSQGCAWTDSFYVGMLWLDYMRTKD
PAIKANIDMQMAEFKQRMKQKRGMNHHDIGFLYTLSAVAGFKLTACGEYRDMAVQAAELL
CERYHSEAKCIQAWGSVEKKENYQLIIDCMLNIPLLYWAAQTTGEKRFYDIAYNHAKTTM
ANIFRPDYSTYHTFYFDYKTGKPLYGKTKQGASDDSTWSRGQAWAIYGFALSFGYTGDAA
FLNAAKNAADYFIKHLPSDNVSFWDLCFNDGDDEPRDTSAAAIAACGLLEIDSFIGSEND
GYYRKIAEKIVTSLCKNYMSSDEKESILDHGVYSIPDNVGIDEACIWGDYYMLEALTRLF
DEEKYISLW

Enzyme Prediction     

No EC number prediction in MGYG000004881_01414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	37	359	2.3e-125	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.95e-24	42	358	29	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIZ07175.1	6.33e-116	2	362	26	390
QNF27331.1	9.88e-116	2	364	29	395
QKR96300.1	1.10e-115	2	369	14	380
VEE96871.1	1.10e-115	2	369	14	380
QJC67999.1	1.56e-115	2	369	14	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	1.48e-94	2	362	28	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.53e-94	2	362	29	393	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	8.65e-94	2	362	29	393	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	8.65e-94	2	362	29	393	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	8.65e-94	2	362	29	393	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DR77	2.32e-101	2	362	27	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	5.26e-98	2	362	30	394	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	8.38e-94	2	362	29	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	5.88e-83	16	359	16	364	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
T2KLZ3	8.67e-58	42	358	77	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004881_01414.