CAZyme Information: MGYG000004884_00963

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615
• CAZyme ID: MGYG000004884_00963
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		28378.65	9.8562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004884	2896455	MAG	China	Asia

• Gene Location: Start: 8840; End: 9580 Strand: +

Full Sequence      

MQKNRIPKVIHYCWFGGKPLPGDVRACIRTWQKVCPGYRLQRWDESNTPIGDWPFAKAAY
QAGAWAFVSDFVRLQVINQYGGIYLDTDVELRKSLDPLLRYDGFFARQQSGEINTGLGFG
AKAGLEPVRAMLREYETAEFSPKRMQELMCPVLNTRALERLGFHQTEKPEQKDGVIVLSP
EYMDPYSSGDKVENLFCERTISIHHYSASWTSGRQRIKRRLIRIIGEDRLLWIRTMKTRA
AAGKQK

Enzyme Prediction     

No EC number prediction in MGYG000004884_00963.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	24	100	6.5e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	7.76e-17	6	142	82	223	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.30e-14	21	105	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.76e-09	2	105	42	150	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN36351.1	3.10e-77	6	230	2	227
CAI33148.1	2.60e-76	6	239	2	237
CAI33168.1	2.60e-76	6	239	2	237
VEE22713.1	4.05e-76	6	244	2	241
CBL25448.1	2.75e-75	6	210	2	208

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	2.66e-09	2	119	53	174	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q5UQW4	7.66e-06	6	115	2	117	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999990	0.000048	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004884_00963.