CAZyme Information: MGYG000004884_01092

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615
• CAZyme ID: MGYG000004884_01092
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000004884_99|CGC1	63503.83	5.0499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004884	2896455	MAG	China	Asia

• Gene Location: Start: 73; End: 1722 Strand: +

Full Sequence      

MHCPDKKELAAQRAYVFRERPLISIVIPVYKPQLRHIKAMIRSVQAQTYDNWELCLAFYG
SKDDEIGQYLRNAIHNCRKIKVKHLKDNYGIAGNTNKALEMAAGDWIAFADQDDLIREDT
LFEYVKTINFSDVDVIYCDEDKLDDETGMYFEPHFKPDFNIDLLRCGNYVCHMLAVRKEL
AKEVGPLKPEMDGAQDFDFTLRLSEKTNKFAHVSKVLYGWRSHRDSTALNPESKMYAFEA
GVRALQQHYARIGIDAEVDMMKVKGWYRTRFHLKETPLVSVIIPNKDHSSDLTRCVESIR
TKASYQNYEILIVENNSTEEETFRTYEKLQEEDSRIRVITWPGHGFNYAAINNYAVEQAK
GEYLLLLNNDTEVITEDLFESMLGYCMREDVGAVGARMFFEDETVQHAGIVVGVTSGAEP
LFVHYNREEPGYMGRAIVSQDLTAVTAACMMVKTSLYREVGGMEEAFAVAYNDVDFCLKL
RDKNYLVVYDAFAELYHYESQTRGYDSEGEDRSRLEIERELLCRRWPNAMHGDPYYNRNL
SLENGYYVI

Enzyme Prediction     

No EC number prediction in MGYG000004884_01092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	24	184	3.1e-23	0.9882352941176471
GT2	280	408	2.1e-20	0.7411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.09e-87	21	221	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.93e-42	281	499	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	3.44e-24	24	227	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.80e-24	276	529	2	244	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.06e-18	24	180	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24563.1	7.06e-195	2	544	261	806
QHB25117.1	6.42e-193	2	543	264	806
QRT31219.1	6.42e-193	2	543	264	806
QEI32629.1	6.42e-193	2	543	264	806
QNM10215.1	9.99e-192	2	544	262	805

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.55e-124	21	549	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.32e-87	10	542	307	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q4UM29	1.47e-13	21	385	14	395	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
P71057	9.67e-11	19	250	2	239	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
A0A0H2UR96	7.30e-09	22	164	4	144	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004884_01092.