CAZyme Information: MGYG000004884_01249

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615
• CAZyme ID: MGYG000004884_01249
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MGYG000004884_122|CGC1	52013.94	5.7669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004884	2896455	MAG	China	Asia

• Gene Location: Start: 3334; End: 4728 Strand: +

Full Sequence      

MTYSNGKMSDVRIAYIGGGSRGWAWTFMRDLALEPALSGTIVLYDIDQEAAKANEIIGNK
ISAMDEAVGKWNYVVAGSLQEALTGCDFVVISILPGTFDEMESDVHEPEKYGIYQSVGDT
AGPGGMVRALRTIPMFVEIAEAIKAYAPKAWVINYTNPMSLCVKTLYHVFPEIKAFGCCH
EVFGTQTLLAKIAEHELGLKDIKRQDIMVNVLGLNHFTWFDRASYKGIDLFPVYRHYIDE
HFEEGFIDGEKHWMNSSFSCAHCVKFDLFNHYGWIAAAGDRHLAEFMPPIYLKDPETVAS
WKFGLTTVAWRKKDLQDRLEKSRKMVSGEEKIKLEPSGEEGILLIKALCGLTRMISNVNI
PNTALQIPNLPASAVVETNAVFSRDSITPVVAGPLTDEIRELILPHVMNHEDVLKAALTC
DYDVMLRAFRRDPLVTCSKADAETLLKTMIRNTKKYLPEGWQNL

Enzyme Prediction     

No EC number prediction in MGYG000004884_01249.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	192	8.6e-57	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.51e-160	11	449	1	419	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	3.47e-106	8	459	1	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.19e-65	11	459	2	429	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	3.72e-57	12	192	1	180	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	7.11e-48	12	457	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU08117.1	6.33e-245	1	462	1	465
QOV18776.1	1.88e-244	1	462	1	466
ABX43749.1	1.54e-243	1	461	1	464
QOV18468.1	5.10e-242	1	462	1	466
ABX43208.1	5.17e-240	1	462	23	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	1.05e-151	7	451	2	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1OBB_A	1.15e-25	8	433	1	449	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
5C3M_A	1.09e-23	39	459	34	436	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	7.39e-22	80	459	78	439	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
7BR4_A	7.87e-17	11	433	13	450	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	3.07e-244	1	461	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	5.74e-204	1	462	1	462	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	2.05e-184	1	461	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	2.06e-155	8	451	7	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	5.55e-39	12	459	3	430	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004884_01249.