CAZyme Information: MGYG000004884_01364

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615
• CAZyme ID: MGYG000004884_01364
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1088		123569.07	5.0625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004884	2896455	MAG	China	Asia

• Gene Location: Start: 3906; End: 7172 Strand: -

Full Sequence      

MTQKQNLRFHWHFLCADQFPLREALNGHTDSNGRFFYETDYQEDNWKEVTLPHTFNDEDL
FRDRIQDGGSGQKRTVSFYRKWIVLPKEAEDGKVLIAFEGMRQTCYLYVNGILAGCYEAG
TAPFGFDLTQYLRFGEKNLLAVATDNTSTRNIPFCIAETPAQESSQPGTYLLEQDSSIPE
GYHHGVGYFWNCNDFNPTIGGISRPVHLYLKPKMHLTLPLYSNLQTKGSYLYAADFDWSR
KTAVITAEAEIRNETDQPKEAWIEVTVRGHRGETAAVFSSEKRVIAPVGEQTSAKTLVPE
DAYIWDEASQQYVPQAEDQVSPTQTESKHTEILCAQSVQVPLDFWSIDHPYLYQAEISLM
TEDGCIDREVIETGFTEIGYDKDRGVLLNQKAVWLRGYAQRAANEWAAIGIAPEWLKDED
AALIRESNANHIRFMHVAASPADIRSFDRNGIVCTQPAGDKERENFGRQWDQRVELMRDI
IIAFRNHPSIVFWEAGNNSIGKEHMREMRLLKEALDPKRGRFMGCRTINTEEVLNESEYV
GTMLNRHAARFLAEHGPITETEYLREEAPRRIWDDFTPPDYDYDNRWLGKGGRKQVGADF
YDLTSEDLALASAKGYSEFFNDRIGGASHHDWYSACAALCWTDSAQHGRQSFSENGRMSG
RVDAVRNKKQSFDIFRVMQSLSPEIKIVGHWNYPDDTPENYWYPEKRFNGNVWEKTGRML
RRDPHHKTVYVFGSYPIARIDLFLNGKPVGSCCKPDDTFVFAFPDIDITEHGTLSAVGYD
FHGAVAAHDSLETAGKPARLEVTVHTSPAGLLADGQDVAYADLRIVDDKGRLCPLCDSKI
RFELKGEGIFLGGYNSGRFAGYGKNDSVIHTDHIYAECGTGRVFWRSTMTAGEIFLTAYM
DGILPVSFSVQSVPVRQDETDWAVPVSYRTDHFPETSGSQEIQAIEEADQLKYHSEDQLY
CKILINGQEPDTRGVRSVNKNGSIWGAVLCILERLKNEWDHAFSYNYDEAGKRLTLTSGG
HTIIAEAAMTHLLADGKENLMDGEPYVVPETRQFVMEINAIVSYIEGITAWYDDKVNVFR
IETHPERK

Enzyme Prediction     

No EC number prediction in MGYG000004884_01364.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	524	1.3e-62	0.48404255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.45e-24	1	524	9	432	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	8.41e-16	79	519	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	1.81e-13	811	907	10	101	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	1.55e-12	18	567	20	492	beta-D-glucuronidase; Provisional
PRK09525	lacZ	3.68e-10	79	519	124	483	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA20342.1	0.0	2	1082	8	1087
QGH35456.1	0.0	6	1082	20	1096
AGT88372.1	3.60e-175	39	912	22	791
ADJ49535.1	3.60e-175	39	912	22	791
QMV17606.1	6.97e-153	46	915	76	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	2.19e-132	31	915	49	807	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	4.06e-31	41	850	49	762	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6B6L_A	5.28e-29	46	910	34	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	5.33e-29	46	910	34	775	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED1_A	5.56e-27	16	519	24	447	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	9.74e-132	31	915	40	798	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.38e-30	41	872	66	824	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	5.18e-30	37	898	23	723	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q56307	1.54e-16	36	499	61	442	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
A7ZWZ1	1.78e-13	90	519	136	483	Beta-galactosidase OS=Escherichia coli O9:H4 (strain HS) OX=331112 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004884_01364.