CAZyme Information: MGYG000004884_01405

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615
• CAZyme ID: MGYG000004884_01405
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		49246.09	4.535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004884	2896455	MAG	China	Asia

• Gene Location: Start: 5167; End: 6492 Strand: +

Full Sequence      

MQYNIMDYGAIPDGVTNNQPMIQQAIDACAKTGGTVVIPAGNFLSGTIRLRSNMELHLER
GSVLTVSRNPEHIRTETEENDSSSDTMDNIDSGSFLYACHEKNITISGDGMIDGQGRNVY
VDDNADEGMHECPLNVEGFRPRTSYLEDIDGLTVTGITFYDASFWTLHMAGCRNVRIDGI
QIRNNDRGPNNDGIDPDACQNVIISNCMIESGDDAIVLKATKPIWEKYGNCENIVIRGCI
LHSRDSALKIGTETYGDIRNVILSDCIVKDCSRAVGIWARDGGTIEDIYVHHILANTKRY
ADCPKRSFAPRWWGKGEPVFVSAAFRNQEKRYPGTIRRVAFEHVQLFCESSIFIAGEQEA
RIEDVVFRDCCFTWKKQGNFLPDVFDEQPSVHDVYPHEIPWLYVRSADGISVSGQYVIDE
SLAGYVGETAEIEDSSRIELP

Enzyme Prediction     

No EC number prediction in MGYG000004884_01405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	27	378	1.1e-62	0.9323076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.69e-63	3	298	83	399	Polygalacturonase [Carbohydrate transport and metabolism].
PLN03003	PLN03003	4.60e-14	4	220	25	217	Probable polygalacturonase At3g15720
pfam00295	Glyco_hydro_28	5.27e-14	102	300	51	242	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	1.05e-11	3	216	37	230	polygalacturonase/glycoside hydrolase family protein
PLN03010	PLN03010	8.33e-11	3	218	47	234	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX43571.1	9.75e-145	3	415	50	461
QEH68079.1	1.69e-60	1	413	1	412
BCJ96758.1	1.20e-54	1	395	1	400
AKQ47633.1	1.31e-54	3	412	40	424
ADY36938.1	4.56e-54	3	389	31	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	4.31e-25	3	220	45	277	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	6.42e-21	2	220	27	267	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
2UVE_A	1.18e-15	4	216	158	405	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MXN_A	7.03e-14	3	207	22	212	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
2PYG_A	9.45e-06	1	43	1	44	Azotobactervinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYG_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYH_A Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii],2PYH_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	6.01e-20	4	229	64	284	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P35339	6.76e-13	3	216	41	236	Exopolygalacturonase OS=Zea mays OX=4577 GN=PG2C PE=2 SV=1
Q9LW07	2.52e-12	4	220	25	217	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
P35338	5.08e-12	3	216	41	236	Exopolygalacturonase OS=Zea mays OX=4577 GN=PG9 PE=2 SV=1
P26216	6.77e-12	3	216	41	236	Exopolygalacturonase OS=Zea mays OX=4577 GN=PG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004884_01405.