CAZyme Information: MGYG000004885_00182

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000004885_00182
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1109		122379.83	4.4742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004885	1991431	MAG	Spain	Europe

• Gene Location: Start: 103818; End: 107147 Strand: -

Full Sequence      

MNRSTLLGLATLLLPLSGAAQLHIGFETNDSYTGLGVYDSWEESPFRTGDLQGNVKVIAN
ELTQEDEILGIAPNATEKMLAVQCSRFGSNRFGARIDLANPFELNTTVKYVHVFINKPTE
GRVMLIGLGKRTERADQSAETEQFSVLSTAKVTPGKWSDAVFAIKGAGGIEIRSLVVVPE
CESPHNRTEDFAAYIDEIEINSVPTPRVIYGDYPLNYEATQVSGKSGNYLNSIALNGSTD
GSQTIAVGSNDPQYIYRDLLGKTFTAKAGETLTPSFSFTSNWMNGYVYLDRGNDGKFTAD
LNEDYTIPEGSDIMTYSYVETVENTEGYKSDGTKISGNARNFINPPAFRLPSDLANGFYR
MRFKVDWGNVDPAGRNTSTNSIVQNGGMIVDVRMNIHSDEISVSRVGGLNGDLLNEDGTE
LVTRTVPFGQPFTIAVQPASDNFELSYIRVRHGYNLTGDSLVHGTPQYVDEIIPAYLFRD
NKYTIPAEYMDGDVVIEPYFIDAGVAPSEDDYALNFATDLTVTRTDRRLNSFTFAATQGG
SSTVTLDTEGTNYVYRDMTHKQVSVVPGDAVATTVDYTGRAMHLYLYVDLNNDGHFSTAL
DAAGAPQVNSELLSYTYYQGRNSLGAEISGTPGSVAVNSMPEFSIPSVLPAGTYRARLKV
DWDNIDPAGHWNENEGNKINDNGGYVVDFLLNVHNAQHKLTLITANGSINGTGNTALPLT
LPVFQALDVVPTPIAAGYTAEKMTVRHGHNFDGPQFIHGNRQWSEYEVDAAACTLPADSI
DGDVMLSVAFEQGDDAEYTLIFSDEFDEPDGSLPDASKWGCSERHGATWNRWIADDPRVA
FLQDGQLVTRAIPNPDPTRYEGDMITGAIQTRYKFGWQYGKIEARILTNPHTGNFPAFWL
MPDDQSLGWPNDGEIDIWEQIDGQNTAYHTLHTGYRQSMKAFQESCPMDRYHTYGFEWDA
EKMIWYLDGKEVGRYRNGEFSDPRAWPYDKTFYIILNQSVGNGAWARPADITHTYETRFD
WVRVYQKDGQNYCMGDQQFVTGISSAEAAGTLDASAGKGCIRLSSPNAVEARIYDLAGRL
VFSKQLKGTETVPVQTGIYVVNGKKLLVP

Enzyme Prediction     

No EC number prediction in MGYG000004885_00182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	803	1025	6.1e-50	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.02e-57	802	1025	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	3.43e-29	798	1026	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	4.86e-28	804	1025	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02178	GH16_beta_agarase	2.95e-21	802	1026	25	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd08024	GH16_CCF	2.08e-18	800	1001	1	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	3.24e-183	9	788	13	779
QFQ13169.1	5.45e-88	510	1027	23	542
QUB75565.1	6.59e-78	789	1107	39	333
BBA29449.1	4.55e-77	796	1107	46	333
QUB58617.1	8.65e-77	796	1107	46	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	7.03e-30	796	1027	22	268	ChainA, GH16 family protein [uncultured bacterium]
3ILN_A	2.06e-27	798	1022	5	250	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
2HYK_A	8.09e-25	795	1026	4	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
3ATG_A	2.60e-24	800	1025	5	238	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
6JH5_A	3.46e-22	869	1027	70	233	Structureof Marine bacterial laminarinase [Aquimarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	1.11e-30	797	1026	55	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	1.06e-28	798	1022	40	285	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	8.02e-16	798	1001	20	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
O33680	1.46e-14	802	1028	222	460	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q27082	5.42e-13	797	1036	24	263	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.999070	0.000169	0.000156	0.000150	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004885_00182.