CAZyme Information: MGYG000004885_00950

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000004885_00950
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		30977.34	5.0815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004885	1991431	MAG	Spain	Europe

• Gene Location: Start: 6328; End: 7146 Strand: -

Full Sequence      

MKAKKVLFITQELTPYVPESPMSVIGRKLPQAIQDSGREIRTFMPRWGNINERRNQLHEV
IRLSGMNIIIDDTDHPLIIKVASIQAARMQVYFIDNDEYFHKRKMMSDDNGNEYEDNAER
AIFYARGVLETLKKLRWCPDVIHCHGWMSAIVPLYIKTAYREEPPFVNTKVIFSAYDEMP
GKAPVPNFAECLSFREANADFLKGTGIDLTAADAYGKLAVTFSDGVIQGSEGIHPELMEY
ARAKNIPTLEWPGEENLSECYGNFYEQIAGAE

Enzyme Prediction     

No EC number prediction in MGYG000004885_00950.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	231	5.2e-41	0.4533898305084746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	4.03e-51	6	174	1	164	Starch synthase catalytic domain.
PRK14098	PRK14098	2.10e-45	5	174	7	177	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.28e-34	5	174	1	163	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	1.03e-23	5	174	2	152	glycogen synthase GlgA.
COG0297	GlgA	2.77e-21	5	174	2	163	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY34869.1	1.12e-123	1	255	1	254
QFQ11960.1	4.35e-120	1	268	1	268
ADV43462.1	6.21e-119	2	272	3	272
QUT97997.1	1.21e-118	2	268	3	268
QRQ48309.1	1.71e-118	2	272	3	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNG_A	1.05e-06	2	197	38	240	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]
1RZU_A	1.29e-06	6	169	3	161	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SC83	7.27e-41	5	262	7	258	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B3EGV0	1.41e-40	5	209	7	213	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
Q3B6C3	7.35e-40	5	177	7	180	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
Q8KAY6	1.01e-38	5	272	7	264	Glycogen synthase OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=glgA PE=3 SV=1
A1BIY8	1.03e-38	5	177	7	180	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999642	0.000362	0.000041	0.000002	0.000001	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004885_00950.