CAZyme Information: MGYG000004887_00665

Basic Information

• Species: UBA1417 sp002305575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp002305575
• CAZyme ID: MGYG000004887_00665
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
891	MGYG000004887_7|CGC1	101838.62	4.8381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004887	1742912	MAG	China	Asia

• Gene Location: Start: 38517; End: 41192 Strand: +

Full Sequence      

MYTISLHGTWKLRGEFLDVTADHFTDVLRRMDADPIAPTLPSFLKLEDLPEEARAQFEAG
PSRAFTVYTDRGPNAFPSKTGWIPMTVPGDVTSALIDAGIVEEPFLKTNTKKNLWIRDLS
WWLVKDFEVSESVLQQDIVRLQIEMLDFNADIILNGTPVAHHANAFCAFSEDIKRFLRVG
ENRLVIRLTSGMELHYPKDSVAFYCGSENAICDQRVYTRKPQFTYGWDWCQPVPTCGIGR
SIGIEAFSGARVSASRVDTLALHGEAAEIEFHFEIEKSNMVQSAETELEYALEIDGKTAF
SGQQTLMLVGGVNYASVRVTLENAKLWWPNGYGAQNLYTFTARCTANGITNEMPAKHIGV
RTLEMDTSKREDGTRNFFFKVNGTRIFCKGGNWVPTDSLYLRTPDESYETLVREGAAANF
TMFRMWGGGTYEPDCFYEYCSKYGILLMHDFMYACGFYPDHLDSFLWEAEREAEYQTKRL
AHYPCMAVWTGNNEIAESYSDWFPAQIRPDRFYGEKIFNYIQPRAVHRNSPLIPYLPSSP
YLGERANVTEEGDVHAWTYFGRDPRTKFKFVYELEAFDRIPARFSSEYGFFGAQMESTVR
RYHDGEPMAFDGEIWKHHGEFERKRGNIDGAIQRHLTEFSTLDIPGYLLYSGIMQGLLYA
ELAEAMRQKPYGAGDLIWMYNDCWPETGWTIIDYYLTRKVSFYFLKRAFQPKKLIIRQTE
NGARLTVINETPEPITAEITCGYETFDGAVSGVCTQTVTAAPHSWQQMDLTLAGDLTCGY
YFAKAEGFDTADSLRAYYRDYTFPESHAKVEAVERDGDDLLVTVSADVYTPFAYLMTSDD
RVHYSDNYFTLYPNEKKTIRVENCAETPALHVAGTMPAEKAEQERYTDSWF

Enzyme Prediction     

No EC number prediction in MGYG000004887_00665.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	772	1.5e-72	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.06e-46	70	865	24	788	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.57e-10	813	862	8	57	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	2.69e-07	265	361	14	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam18368	Ig_GlcNase	2.83e-05	798	862	9	85	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97926.1	1.04e-299	1	864	1	839
BBI35730.1	2.01e-188	79	861	30	824
QGQ95120.1	2.41e-178	82	863	33	828
QJD84888.1	1.63e-172	81	861	33	824
QTH41537.1	1.93e-167	79	862	29	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	5.98e-103	82	860	43	809	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	7.50e-102	82	859	25	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	7.83e-102	82	859	27	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	8.00e-102	82	859	27	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.06e-101	82	859	25	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	7.31e-77	78	718	22	662	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q0CCA0	8.64e-75	78	726	22	668	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A2QYN2	8.78e-75	78	726	22	670	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q2TXB7	1.11e-73	53	726	3	670	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	1.52e-73	53	726	3	670	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004887_00665.