CAZyme Information: MGYG000004887_01158

Basic Information

• Species: UBA1417 sp002305575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp002305575
• CAZyme ID: MGYG000004887_01158
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000004887_13|CGC1	42276.62	5.0817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004887	1742912	MAG	China	Asia

• Gene Location: Start: 51196; End: 52287 Strand: +

Full Sequence      

MDKIHGVNLGNWLVLEKWMNPALFEGVAAEDETDLCKLLPRDELVARLKKHRDTYITLDD
FKWIKAHGLNTVRIPVPHFIFGDDPKFCDPYVPCIEYLDQAFDWAEETGLRILIDLHTAP
DSQNGFDNGGICGVCKFWQKPENEARVVKVLGMLSARYANREALFGVQILNEPISPEVWP
HIVGRYPPTDPAYAAGSGPVPFEFLCSFYKKAYHEIRKYLGEDKVVMFHDGFRLKMWKEF
MQTDEFKNVWLDTHIYMMMPGEMETKDYVQIVLERCRNDIREMAQYFPVVVGEWCLSHNP
KGINEMTDWQKKLSYRMMADAQLTAWDESAGFFFWSYKLISEPAGWDFRKCVEKGWLPEV
IGE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	338	3.3e-107	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.36e-25	1	179	15	200	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.20e-04	55	173	23	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79423.1	3.56e-133	1	358	1	367
QRT49144.1	2.94e-126	3	360	2	388
AWY98291.1	1.05e-122	4	358	3	386
QJU19071.1	1.21e-121	4	358	3	386
QQR01615.1	6.46e-121	4	358	3	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	4.17e-110	3	358	2	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	3.36e-109	3	358	2	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
2PF0_A	1.27e-40	4	361	15	388	ChainA, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	1.57e-40	4	361	9	382	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.77e-40	4	361	15	388	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	6.81e-51	2	358	29	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	6.81e-51	2	358	29	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
B0XN12	1.02e-47	4	361	42	406	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q0CR35	2.79e-47	2	358	38	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
A2RAR6	2.79e-47	4	358	42	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004887_01158.