CAZyme Information: MGYG000004889_00068

Basic Information

• Species: UMGS1591 sp900553255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591; UMGS1591 sp900553255
• CAZyme ID: MGYG000004889_00068
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MGYG000004889_2|CGC1	89202.3	5.6583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004889	2521508	MAG	China	Asia

• Gene Location: Start: 3007; End: 5352 Strand: -

Full Sequence      

MEHKAQWIWRRKQAVDESEYLLFRKSVVYSRPPIKAEITVTADSCFVLYINGERLLRGPT
KSDLSLRYTDTVDLAPHLRQGENVLAAEVIHYPGNRHLANEFKAGPTALMSSMQGGLMID
GDPAWRTDASYHCLPLEAYRFTSVADTDLIYMGHFEDVDGALYPAGWKEAGYREENWKPA
VEITENSPYIMGGLANVWQVEPNPIPRPYEEKVSLQRVTRCSASAASQAQHLLAGEWLEL
PAGEDAWIELDAGEYRTAFPEWEIEGGRGAEICLIYAESYGFDRDGKYIKAARDDCSREG
SYLKGGRDVYRPDGRRQNYCPFHYRAFRFIRVEIHGGGQAVKIRLKAVWQTGYPLAVQSR
FHSDAGWMDRIWEVSLRTLKSCMYDTYMDCPYYERMQYLMDTRLEALYGFAVSRDDRLAR
KALRDFYNVQLPNGLLPCHSPANILQIIPTFTFYWIMMLHDHYRYFGDKRLIEGYYPGVE
KALAYFTDRLNGQRLLADTGFWQFVDWTADWERGVPVKSTDEINVIHTLMLVFALRQGAE
LAEVIGRSDCAGHYWQLAEEIGGAVNRYAYDEVRGLYTDTVGRPQWSQHAQVWAVLSGVA
EGERARTILQAAMENPDAAKCSFCMQYFLFRALEKAGLYALTRKQWLLWEQMLEMGVTTW
PEDPVNWRSDCHAWSAVPLQELMSCGVGLRPAGPGFARVHIAPRMYWLGSCEGSCMTPYG
RVTVSWRVTDGCLTVQAETEQPVPVLWELLPGQKYEETVSGRASRTVLLEEQRPAAAVIF
D

Enzyme Prediction     

No EC number prediction in MGYG000004889_00068.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	250	736	6.6e-105	0.9523809523809523
CBM67	5	184	3.8e-31	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.74e-30	370	676	15	330	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.19e-09	32	184	2	154	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.61e-08	688	762	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17167	Glyco_hydro_36	3.86e-04	530	615	207	302	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK59208.1	1.03e-184	1	742	1	747
QHT59893.1	1.65e-168	1	756	1	778
BBH24613.1	2.94e-162	4	755	8	790
QTH43327.1	1.46e-161	4	753	8	784
QJD82735.1	1.71e-161	5	758	13	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.05e-47	240	758	429	950	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	1.11e-16	325	740	271	699	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004889_00068.