CAZyme Information: MGYG000004891_02605

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KM106-2
• CAZyme ID: MGYG000004891_02605
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		44128.43	5.3096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004891	3652874	MAG	China	Asia

• Gene Location: Start: 14338; End: 15480 Strand: -

Full Sequence      

MKGIFNICPYAYYRNEQFMKDCILIPYTISKLYGYQATIVTKQKEEFTYLPLLPNLQTDI
IPNNEETENWTDFCTQFISKNYKNIDLLFCFGSYEANQAMVPLYKKLRPDGKVILKLDAN
SGWMDRLSMSNESLYKMYENCDLITCESKRLKEHLSKKWPFQIDYVVNGSLDNLFLHKPS
SYQQKENILLTVGRIGTAQKANHILLEAFAMYHDCYPDWTLRLVGSVEPSFEPYINDYFS
RYPELIDRVILTGKITDKEKLYEEYQKAKVFAITSVYEGGTPNVFSEAAYYGCYTICSDI
DASYEFTNGSKCGSVFPVGDSSSLAEILKQVLSPSFEPVLESNFAEIQTYHHRFFNYETI
AKKLMHLLTLKEEIFKNAEF

Enzyme Prediction     

No EC number prediction in MGYG000004891_02605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	184	333	1.9e-21	0.89375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	7.68e-26	78	333	76	332	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.55e-24	24	368	24	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	6.42e-23	83	360	82	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam13692	Glyco_trans_1_4	1.23e-20	186	333	1	137	Glycosyl transferases group 1.
cd03820	GT4_AmsD-like	1.63e-19	135	326	133	314	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH42285.1	1.24e-133	2	370	3	368
QJC53766.1	1.25e-121	2	372	3	378
QGG58089.1	1.07e-117	2	370	42	409
AIY11631.1	1.73e-82	15	370	10	358
AHM68239.1	2.41e-82	15	370	21	369

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004891_02605.