CAZyme Information: MGYG000004891_03089

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KM106-2
• CAZyme ID: MGYG000004891_03089
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000004891_61|CGC1	38322.59	5.9736

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004891	3652874	MAG	China	Asia

• Gene Location: Start: 7611; End: 8582 Strand: +

Full Sequence      

MNEFKTYQNGINLGGWLSQCEHTKQHYDTFLTKKDLHWIKEHGYDHVRLPVDYEVVVTDH
GEWKKDGFSYIDRCISWCKEEGLYMILDLHKTKGYTFDEPKSAYNFFKDPSLTEFFLNIW
EENARRYKNEKIIAFELLNEIVPYDVADQWNRIAEKAIERIRVITKDTYILVGGVCYNSI
STVPLLKIARRENVVYTFHCYEPFIFTHQEAEWVDCIPKGIKVKYPESFDEVKTNLAGSI
QQLLKERNINEFGKEFFEALFEQAVNYAKEQKVPLYCGEYGVICYADELSKKRWFQDIEE
VFGKYKIGHASWNYKSLMFGLHD

Enzyme Prediction     

EC	3.2.1.-	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	319	6.3e-120	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.26e-29	16	314	9	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.88e-23	7	315	51	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN29487.1	7.79e-119	1	323	1	324
AIQ42917.1	2.75e-96	1	323	1	323
CBL34054.1	1.44e-94	1	323	1	327
CBK95738.1	2.03e-94	1	323	1	327
QUL53328.1	5.08e-94	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.35e-80	6	323	3	324	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	3.81e-80	6	323	3	324	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	6.15e-27	39	323	42	296	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
6UJE_A	3.30e-26	10	323	13	294	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
3AMG_A	4.35e-26	39	323	42	296	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23340	1.04e-79	6	323	3	324	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	1.04e-79	6	323	3	324	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	1.48e-79	6	323	3	324	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	1.40e-69	10	307	10	286	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	1.14e-18	5	314	308	633	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004891_03089.