CAZyme Information: MGYG000004891_03092

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KM106-2
• CAZyme ID: MGYG000004891_03092
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000004891_61|CGC1	37506.09	4.8651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004891	3652874	MAG	China	Asia

• Gene Location: Start: 10725; End: 11720 Strand: +

Full Sequence      

MNTKELHREITVGTSLSSDYHTINEALASIPADNEVPTTIFIKNGIYEEKLMITQPFITL
VGEDKENTQITFGDYAKMTFPDGSFIRTFNTYTVFVGANDVTIKNLTIKNSAGLGEKVGQ
AVALYVEGSRVKVEDVRLIANQDTLFTGPLPHKPIEGSTFGGPMEGKERVVGKQYYKNCY
IQGDIDFIFGSATAVFENCELYSNDLGKEENGYVTAASTYEGQEFGYVFMNCRFTSDAKK
ETVYLGRPWRDYAKTVLIHCEIGEHIHKEGWHDWNKELARRVAFYGEYDSYTHEQKPAVL
DQRVPWSHILNEEDVAKYTLANILGPDEWYK

Enzyme Prediction     

No EC number prediction in MGYG000004891_03092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	324	4.4e-94	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.34e-93	19	324	93	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.21e-68	10	327	2	298	Pectinesterase.
PLN02432	PLN02432	2.87e-61	10	329	13	291	putative pectinesterase
PLN02708	PLN02708	5.85e-55	4	329	237	548	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	2.11e-53	8	328	5	300	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58031.1	9.54e-147	10	329	2	319
AQR96711.1	1.35e-146	10	329	2	319
BAV13196.1	2.30e-127	17	329	8	318
ADL51177.1	2.30e-127	17	329	8	318
AEI32806.1	2.50e-125	19	329	10	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.71e-36	17	331	12	305	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	6.82e-36	10	331	9	309	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	3.36e-32	14	271	38	303	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	8.45e-32	10	325	8	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	5.70e-27	10	325	8	335	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	7.81e-45	8	328	5	300	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	5.00e-43	2	331	74	379	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8L7Q7	6.58e-43	6	329	285	597	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LXD9	1.30e-42	6	329	237	546	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
P83947	4.25e-40	4	329	227	531	Pectinesterase/pectinesterase inhibitor OS=Ficus pumila var. awkeotsang OX=204231 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004891_03092.