CAZyme Information: MGYG000004892_00018

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1858
• CAZyme ID: MGYG000004892_00018
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1346		151308.42	4.8578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004892	1550618	MAG	China	Asia

• Gene Location: Start: 3661; End: 7701 Strand: +

Full Sequence      

MLRTTTCLNGCWDFSPYADTLDTLPAEWDSVKIQVPSPFNVNSFSHGYPRTTAGESYYVQ
GGDFRLYPEYPAEWEKIHTGFYRRTLFVPEESRGKRLFLHFDAVAYRSVYYLNGVRVGEA
TEGFLPIEVEITDHVKYGEDNELIVGAQTVHELFYHDEDGRRRCDYPHGSFWGGHIGGIW
QDAWLCERPAAYIRDIFATTDVYKKTMTVRYEHDGGDGLTIKFFLTKWGEEGATEREVLS
APCDGSELCWQYADGDVALWDVDAPNLYTLTGRLYRDGEAVDETSVRIGFRTFTTEGDQF
ILNGRRIRLKNDSWHYMGYSIQTPDYARAYYRMAKDANVNIIRLHAQPFPSFFYDVADEM
GMLLVSESGVWASHCVFSYNEKFFENSKQHLRRLIRRDRNHPSVVMWSPENECLPAYKVC
GSSAIRDVADLEEKLYDLTQEIPALDSSRLISCDGSGDLGGRMPVNSLHYPGYDCPTHRG
KPITIGEMGSMYFSTPDNVCMEMGAAPLYSFENRLESVARDAFRNLTGQRKWAAQVCVFN
LIWYGLQPIPFAERALTYDDYTAPGIKPSRITPYLRTLNAGAQADLPDYIPNPVWEWTKA
AYTPVRFFAENAPTGVFGGEVARFPLSVFNDHRNAETLTLTAVLSTEDGDTVLPEHTYTL
EACTYTEDVLEVAMPAMTGTATLRLSLRSETEELFEDTLTVSVYDRAALQAEWDAMGVVC
LTGDDADTDAPALDFRKAAPYGSFMKSRSIRHLFRADGGEVHFTASHDGRYFEEYLNFNA
APLYFNGAGMPVILDLTTAGVPHFLCGVELPVLTDEAEALALQVSLGRELKARIAAMKQP
TAAYFYGEAGSAVSAMLDEIRCDYEVIDDAKLHELLRTPQTALLIADGSRSTDWLEDVSA
ANFPNVLVLGLTAAPRMLFNEFEVTAQRGFHLQPKTADALTAGMYGNNLYGLGVGREEAL
ADRLLQYKHASDSILLGVPNVDWRMWNNNAENLKTVSILRSELADRSRLAALVRHDYAGS
RLYFSQLSLNTQSKKAKNLLVRMLSALGTGISLAQNDDLNELLYAGMYGVRINRMLCRRL
KADEDVTALHPGLNRVENGETWRIVNAADRLDDCALAVFVYSPQDRTDLLLNPDTIDLHV
EADKEVTLYLGGEQQGSGTDFTVTSITLAAGWNTLLLRCAGGQTLPKLSFHRTNLKKSDL
KCGLYDVDLKLQNMQKATLHSDDRPDGVERAIAGREQHWRASADQHEGIDFGFDFPAPIT
CRALYFSGLPSDFDRDCFTPYCFRLLAGDSADDLHEVYRSRFEDKMSYVNGKVFLRLDDV
TARCFRLELTHNALKPWIISNLNVLL

Enzyme Prediction     

No EC number prediction in MGYG000004892_00018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	702	5.1e-92	0.7167553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.58e-41	8	412	15	406	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.17e-40	3	453	10	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.54e-31	8	412	44	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.61e-18	8	413	55	463	beta-galactosidase.
pfam00703	Glyco_hydro_2	6.74e-14	191	291	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYL93856.1	2.93e-110	3	613	44	689
AXY77942.1	5.19e-106	3	601	48	680
AEU36553.1	4.75e-104	3	601	69	712
ANI89968.1	5.64e-96	3	543	54	617
QDO68986.1	8.46e-95	3	604	53	698

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	3.46e-27	8	474	41	488	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.47e-27	8	474	42	489	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6D89_A	6.47e-26	94	412	114	413	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	6.80e-26	94	412	122	421	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]
6ECA_A	1.81e-25	3	412	38	439	Lactobacillusrhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	6.73e-28	79	433	103	454	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
Q56307	1.90e-26	8	474	42	489	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	5.11e-25	79	407	57	382	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P24131	7.02e-25	8	455	49	486	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2
O52847	8.25e-25	8	412	61	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004892_00018.