CAZyme Information: MGYG000004892_00053

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1858
• CAZyme ID: MGYG000004892_00053
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase GanA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		34518.93	5.8801

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004892	1550618	MAG	China	Asia

• Gene Location: Start: 11655; End: 12536 Strand: +

Full Sequence      

MYDPVDRHFPHLLHGADYNPEQWIRTPEIWDEDMRLMKLAHINAVSVGIFSWAALEPEEG
VFRFDWLDTIMDKLAENGIRAILATPSSARPAWLAQRYPEVLQVREDGTRIQFGIRQNHC
LTSPLYREKTALINRKLAERYADHPALSLWHVSNEYGSVCHCELCQRAFRDWLKKKYDGD
LDRLNFEWWGSFWSHTYTDWEQIHSPTYIGENLANALKLEWRRFVSDQNISFFENEIAPL
RELTPHVPLTTNLMGTFDGIDYQKLARHMDVVSWDNYPDWHNAPPLYTTSIAR

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	17	282	6.6e-118	0.7142857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	5.74e-134	17	279	1	264	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	1.18e-103	10	283	14	288	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL68213.1	1.33e-143	2	281	4	283
AFK86287.1	1.53e-143	2	281	4	283
AST58220.1	2.13e-142	2	281	4	283
SNX53392.1	5.84e-142	2	281	4	283
AEY65039.1	1.77e-140	2	281	4	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DFA_A	3.58e-136	12	282	15	291	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
4OIF_A	3.58e-136	12	282	15	291	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]
4OJY_A	3.68e-136	12	282	16	292	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
5E9A_A	3.09e-113	12	281	39	307	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
3TTS_A	6.23e-89	5	293	2	291	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX4	1.98e-129	12	282	1	277	Beta-galactosidase GalA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=lacA PE=1 SV=2
O07012	3.07e-128	12	282	1	277	Beta-galactosidase GanA OS=Bacillus subtilis (strain 168) OX=224308 GN=ganA PE=1 SV=2
C8WV58	5.37e-121	4	281	6	282	Beta-galactosidase BglY OS=Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) OX=521098 GN=bglY PE=1 SV=1
Q0TUR6	4.37e-120	2	281	4	286	Beta-galactosidase Pbg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbg PE=3 SV=1
Q09HN2	2.91e-94	5	278	2	279	Beta-galactosidase BgaP OS=Planococcus sp. (strain L4) OX=377621 GN=bgaP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004892_00053.