CAZyme Information: MGYG000004892_00391

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1858
• CAZyme ID: MGYG000004892_00391
• CAZy Family: CBM32
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1228		135792.19	4.303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004892	1550618	MAG	China	Asia

• Gene Location: Start: 5401; End: 9087 Strand: -

Full Sequence      

MACVFGATAASVGVTAEDAASGSRNLALRRSVLHSSAANYNDTGHLVTDGIINGDSSQRV
QMTAQYDDSPTGETVNCAFDGQTGTKWLTFHSTAWLQAAFPEESGKTAVTYKVASANDEA
SRDPRAWTLQGSNDGQTFTVLDTRSNETFATRYQVNTYTIAEPAAYRYYRLVVTQNCGDS
RLQLSEFDLLGADGQSLFEAYRDVFNSVWTSKGSGEEWLKLDLGGESKIDSVKLYWADKN
YATEYAIQASDDGEDWRTVAMNQSGEGGVETLTFSETATYLRLLCKKSAGDRYSLSEWEV
YGTNDVQYTLPAQPEPETDGTQYLTGGNWRVQRASEVMAAGETLSGTQYDDQSWLPATVP
GTVLTSYFKAGAIPDMNVADQQLQISDSFFTADFWYRNTFTIPASRRGERTWLNFNSINW
KAEIYFNGEYVGRIDGAFIRGRFDVTELVNYGGDNHLVVLIHKNDTPGAVTVQTKDDAGP
NGGALGADNPTIHASIGWDWVPTVRGRNIGIYGDVYVNYTQEVQLLDPWVVTDLDVESGD
FSKAKLTVRTMLSNPSDKDKDVTVSGTITPSDLTFTSEPIHLKAGETKEVTVATLTMDQP
RLWWPNTYGEQFLYDATLSVSDNGEVSDTKTVSFGVREFTYSAGSPLTISCNGVRIVCRG
GNWGMDDANLAATPEDYDIKIRLHAEANLTMIRNWVGMTNHPAFYEACDRYGILIWDDFW
LANPGDGPNPNDEDMFVANAVDKVRRNRSHAALALYCGRNEGNPPETLNAQLTLVTLTED
GTRHYIPHSASNTVSGFGPYGVQPVSWYFQNTPRTLHSERGMPNIPSYESLLEMLTDEYA
WPINSVWGLHDFCGKSAQGADAFETMMRNGYGEYNSLKEFARIAQMVNYEEHKAMFEAVY
NARGNGLLMWMSQSAWPSMVWQTYDYYYDTNAGYFAIKKANQPIKVYWNCANNLIALSNS
TGQELKNLTVGYKVYDLNGKCVGEWEDVTDCSADDVVGLTMLEVPENATDILFIETYVRN
ANGKTLGSDFYWTNTKESQQYKALNTLSNVTLDTAKCELTAEDGIRRYAVVITNTSDTPA
LMIRLKTTETATGDRVLPVYYDDNYISLMPGQSQTIKLEIAESRLNGGEPVFAVEGWNIT
EATVTAETEVIEDPDDPELLIGDANDDGVVDSSDARVALQHAVGKVTLAGDDAVRADVNG
DRAIDSTDARYILQKAVNKIDAFPAEKK

Enzyme Prediction     

No EC number prediction in MGYG000004892_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	321	1021	1e-88	0.699468085106383
CBM32	206	299	1.2e-17	0.75
CBM32	67	187	2.3e-16	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.83e-49	355	852	30	490	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18368	Ig_GlcNase	7.61e-26	1030	1139	2	104	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
pfam00703	Glyco_hydro_2	8.90e-17	527	637	5	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	7.69e-16	396	761	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
cd14256	Dockerin_I	2.33e-13	1161	1215	1	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59726.1	0.0	22	1149	37	1324
BCI60689.1	0.0	8	1149	24	1209
BCI59728.1	0.0	24	1185	38	1265
QUT49978.1	2.72e-271	24	1139	70	1207
BBK93008.1	1.43e-267	24	1139	72	1206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZO_A	9.22e-65	331	1147	58	899	Crystalstructure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZS_A	9.22e-65	331	1147	58	899	ChitosanProduct complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZT_A	2.93e-64	331	1147	58	899	Complexof Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	9.33e-64	331	1147	58	899	Complexof Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]
5N6U_A	9.61e-46	351	1139	40	830	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q75W54	5.11e-86	329	1138	13	935	Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana OX=3702 GN=EBM PE=1 SV=3
Q5H7P5	1.10e-85	320	1141	2	947	Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum OX=4690 GN=EBM PE=1 SV=4
Q82NR8	8.98e-74	274	1146	11	903	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
Q56F26	1.61e-63	331	1147	58	899	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
D4AUH1	4.32e-47	303	1144	16	882	Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.890790	0.105203	0.002743	0.000379	0.000242	0.000636

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004892_00391.