CAZyme Information: MGYG000004893_00486

Basic Information

• Species: Fusobacterium_A sp900555485
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900555485
• CAZyme ID: MGYG000004893_00486
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	MGYG000004893_3|CGC2	31097.34	8.9946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004893	2280337	MAG	China	Asia

• Gene Location: Start: 144756; End: 145535 Strand: -

Full Sequence      

MIPKKIHYIWLGKNSHPNLMDICINSWKEKLPSYKIEEWNEENLDFDITIKKNRFLQECY
KRKLWAFLSDYFRIKVLYEEGGVYLDTDMQIIKNIDNLLDNDFFIGEESEGVISAGIIGV
VPKHPLIKKILDFYEEEIWNEPIFTIPDIITKVINREYSLKKSGENIKIADRMIIYPSKY
FYPYHFTEEFKYECIKSDTYGIHWWGKSWAQKKDLSKLYFLEFKHYKGIKKVIVETLILT
RTMKYVKNSKILINLSKKI

Enzyme Prediction     

No EC number prediction in MGYG000004893_00486.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	101	8.3e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	7.12e-35	1	225	81	294	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.64e-13	23	104	7	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.98e-05	1	144	45	198	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	4.93e-04	47	89	147	194	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ19080.1	6.97e-153	1	259	1	259
AVQ28665.1	9.31e-131	1	259	1	260
SQJ00557.1	9.31e-131	1	259	1	260
BBA50716.1	3.60e-128	1	259	1	260
AVQ31609.1	5.11e-128	1	259	1	260

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQW4	2.81e-10	1	220	1	222	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q9N289	2.35e-09	68	207	39	184	Lactosylceramide 4-alpha-galactosyltransferase (Fragment) OS=Pongo pygmaeus OX=9600 GN=A4GALT PE=3 SV=1
Q9NPC4	3.17e-09	68	207	174	319	Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=1 SV=1
Q9N291	4.27e-09	68	207	174	319	Lactosylceramide 4-alpha-galactosyltransferase OS=Pan troglodytes OX=9598 GN=A4GALT PE=3 SV=1
Q9N290	2.35e-08	68	207	148	293	Lactosylceramide 4-alpha-galactosyltransferase (Fragment) OS=Gorilla gorilla gorilla OX=9595 GN=A4GALT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004893_00486.