CAZyme Information: MGYG000004893_01414

Basic Information

• Species: Fusobacterium_A sp900555485
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900555485
• CAZyme ID: MGYG000004893_01414
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000004893_13|CGC1	41548.68	9.2408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004893	2280337	MAG	China	Asia

• Gene Location: Start: 28342; End: 29415 Strand: -

Full Sequence      

MKFFVSTGEVSGDLHLSYLVEAIKRKYKDVKFYGVAGNHSRKAGVEVIQDIDELAIMGFT
EVLKKYSFLKKKANEYIDFIKKENIKKVILVDYGGFNLKFLELLKKEIKDIEVFYYIPPK
LWIWGEKRIKKLIKADHIMVIFPWEVEFYKKHGVDAIYYGNPFVDKYVVEDREEEYILLL
PGSRKQEITSLLPIMLEIVKNNRDKKFLLKLSSRDHLKWITENLSDYTNLTLEFEKKLSE
CVKNSKVAIAASGTVTLELALMGLPTIVVYKTGFINAFIAKYILKIGFVSLPNLTLNKEV
FPELLQDRCNVKEIEKALEDIEKNREEMKKNIQEVRERLSGNNVVESYGDFLVKGER

Enzyme Prediction     

No EC number prediction in MGYG000004893_01414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	337	1.2e-105	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	1.58e-122	1	354	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.22e-99	1	342	2	362	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.03e-75	4	339	2	354	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.02e-68	5	346	10	376	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.63e-56	1	345	2	341	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ19865.1	2.73e-215	1	357	1	357
SQJ09670.1	9.86e-188	1	357	1	357
AVQ26961.1	9.86e-188	1	357	1	357
VEH39859.1	2.31e-186	1	357	1	357
AVQ31390.1	2.31e-186	1	357	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.05e-30	8	318	14	341	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.03e-29	8	318	14	341	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2V704	1.72e-53	2	319	3	344	Lipid-A-disaccharide synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) OX=436114 GN=lpxB PE=3 SV=1
Q5ZVR9	4.96e-51	5	320	9	340	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q5X5J5	3.78e-50	5	320	9	340	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Paris) OX=297246 GN=lpxB1 PE=3 SV=1
Q5WWX7	5.30e-50	5	320	9	340	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
C0QR27	6.61e-50	2	316	3	334	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004893_01414.