CAZyme Information: MGYG000004893_02030

Basic Information

• Species: Fusobacterium_A sp900555485
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900555485
• CAZyme ID: MGYG000004893_02030
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000004893_31|CGC1	62939.91	9.8332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004893	2280337	MAG	China	Asia

• Gene Location: Start: 5621; End: 7219 Strand: +

Full Sequence      

MDKQERKYLIILAFISIVAFFSNLWVRPADLMEARNFITAREMIQNDNYIIPTLNDFLRF
EKPPLPTWFTAFVMNITGNVKDEYILRIPVALCGILFIYLLYYFVKITTENKLQSFITAF
IGSTTFMIIKIGNENTWDLYTYVFAFGAILFFIKGLKKEKLIDFFITGIFLSASIMSKGP
IGIYGLILPFLITHIYIYGFSSYKKNILKILFTLIITIIFSSIWPLIIYLKYPDYFLSVL
NKEKNTWSNSHTENFIYYMDYFVYMGIWMFFSVLTLYFSWIKKRSENKNFSKLIFLWNIL
IILALSIIKMKKKRYGIPIYMISIIGVGTICYYYYNKCWDKLKKSDKILLYFQLGFISFI
SITIPIIIFFKGYLLNQVGLTYLIITIISFIPFIIYGIRYILYKKDINTKFIVIGSGILM
LIVNLTSNWFFDTNFINKNEKENIENYTKIKVMRANPPSLNIYSNNFEIEDVWRVGKSIK
PFNINNNLPDKFIFLGEISEEIKSKFYIQKQEIYVKENGDLAKFYYLKKMEG

Enzyme Prediction     

No EC number prediction in MGYG000004893_02030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	433	2.6e-56	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.32e-24	1	333	2	338	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	4.15e-14	62	194	2	132	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	0.003	3	192	3	191	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	0.005	10	195	1	200	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADR19199.1	3.91e-20	1	423	1	401
APC96894.1	1.35e-16	1	490	6	492
QIV96363.1	1.75e-16	33	421	33	428
BAT72501.1	2.61e-16	4	330	2	332
ASK79558.1	1.16e-13	1	422	5	429

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N3Q9	1.06e-10	33	318	36	323	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
Q8D339	1.07e-10	15	349	18	355	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Wigglesworthia glossinidia brevipalpis OX=36870 GN=arnT PE=3 SV=1
O67270	2.22e-10	6	320	3	310	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	9.81e-10	1	372	1	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
C6DAW3	2.14e-08	25	318	29	322	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999973	0.000021	0.000011	0.000000	0.000000	0.000008

TMHMM  Annotations     

start	end
7	29
83	105
112	129
139	156
161	176
181	200
207	229
261	280
293	310
314	336
348	370
380	402
409	431