CAZyme Information: MGYG000004895_01410

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAAEEV01
• CAZyme ID: MGYG000004895_01410
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22293.76	7.3182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004895	1589048	MAG	China	Asia

• Gene Location: Start: 97; End: 699 Strand: +

Full Sequence      

MLALAGAKLPRPYVHFRESLDQLIPYLHTFKGIHLVIVAGSDEEYALHLRRTVSDHDLDS
VTVLDYVEEMAALMNASDLVICKSGGLTVTECLCASVPMILMGRAYGQEKANVRMLTATG
AALHVTTSRELIDTLRHVNEHPESTHAMLINASFLRKPDAAIDIARATLDLAAREPSEDA
KLRKKHFLHFYWGRKPAHTR

Enzyme Prediction     

No EC number prediction in MGYG000004895_01410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	18	160	1.6e-26	0.8980891719745223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0707	MurG	1.47e-22	30	174	210	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd17507	GT28_Beta-DGS-like	2.61e-19	35	167	228	358	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	2.81e-18	58	174	234	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	3.99e-16	31	165	210	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13608	PRK13608	1.08e-15	35	171	234	368	diacylglycerol glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS57039.1	1.84e-92	1	200	211	410
QOS69492.1	9.30e-92	1	200	278	478
BAN76837.1	1.39e-91	1	200	281	480
BCA88843.1	1.51e-91	1	200	284	483
BAK44346.1	1.46e-90	1	200	265	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	4.67e-09	63	172	239	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FED1	2.04e-10	18	155	216	352	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
P54166	2.76e-10	18	151	216	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
C1DQ99	6.53e-10	63	172	238	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) OX=322710 GN=murG PE=3 SV=1
Q1D0T0	6.89e-10	42	171	210	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=murG PE=3 SV=1
Q7U336	2.21e-09	51	172	225	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004895_01410.