CAZyme Information: MGYG000004899_01041

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_01041
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675		77834.79	6.5073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 161073; End: 163100 Strand: -

Full Sequence      

MKKKIIFSLTFAATILCTAKAQDATGLYLNNRAPLMTKSYMELPIGAVRPQGWLKDQMER
MCSGMTGHLDELYSKVMGPRNGWLGGDGDVWERGPYWIDGLLPLAYIMDDVQLKEKVQPW
IEWVLKSQQPDGYFGPYEDRTPESGLQRNNARDWWPKMVVLKFMKQYYDATGDQRIIPFM
TNYFKYQLKELPNAPLDHWTFWGRERGGDNLMIVYWLYNITGDAYLLELGDLLTKQTTDW
TGEFLGRDMLNNLFSVHCVNLAQAMKQPIIRYQATKDRSHMDAIDQAYADLKRSHGWPTG
LYGADELLHTGNPTQGSELCTAVEMMFSLEKMVEITGRTDWADWLERVAFNALPTQITDN
FDARQYYQQLNQVEISRQDRNFVTCYNGTDQLFGLLAGYPCCTSNLHQGWPKFTRNLWFA
TEDRGLAALFYSPSEVTAKVAGGVTVRMTEDTGYPFEGTVRIHFSLPDKKVKSVAFPLHL
RIPGWCKEAVVKVNGKEWSKASSGSIFKVYREWCTGDVIELELPMAISISRWYERSAVVE
RGPLVYALRIGEKWNKVKDDRKFGDRYGDWYYEVHPTSHWNYCLQEESLKPEKIAESFRV
VEKPVSGYPWNLENAPIEIHAKGKRMNEWQLYNGSAGPLPYSTQYQINTLPEEDIILVPY
GCTTLRITEFPVTRK

Enzyme Prediction     

No EC number prediction in MGYG000004899_01041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	110	547	2.5e-34	0.8489065606361829

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.11e-61	81	547	51	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.93e-28	110	551	84	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU60445.1	7.62e-154	1	672	1	650
QNK64903.1	1.07e-153	21	672	14	644
QHS59113.1	4.68e-152	1	672	1	650
AMP98056.1	1.19e-149	1	672	3	650
QIL41453.1	3.73e-147	3	672	2	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.67e-20	38	548	24	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.31e-19	87	560	100	620	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	1.11e-18	38	548	24	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	4.44e-14	277	555	290	578	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.50e-14	277	555	290	578	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.43e-13	277	555	290	578	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998509	0.000595	0.000193	0.000159	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_01041.