CAZyme Information: MGYG000004899_01212

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_01212
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		53988.9	5.9676

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 91063; End: 92484 Strand: +

Full Sequence      

MRKIYFRADASSAIGYGHFIRTLALADMLKDDFNCTFFTCHPTPYQVGEMEKVCPYVTLQ
EEKHYDQFLSYLQGNEIVVLDNYFFTTDYQRAIKQKGCCLVCIDDMHDKHYVADVVINHG
QINPVLFDVESYTKLCLGFDWALLRKPFLEAAKKKRISSDKIEKVVICFGGSDIHDITGY
FVNQALRICAVSSVTAVVGDAYTPHSLRAKDDRLIYRSRLTAQDMADLFCNSDLVICSAS
SVCIEALACGAKVAAGWYVDNQADFYNLLLSNNWVIGLGNVEQPSVDLCNVDLLRSSNTN
MINYVQRRYTSFFRGLADGCYLREARFIDRDLLYRWVNDPMVRQSAFNTDEINYEEHCNW
FAKCLQRDDVWIYILIKNGIPVGQVRLNIENGEALIDYSIASEYRGQGLGCVIIDLISEN
IRCMQHVNYLVAHVKSVNVFSQKVFLKNGFIECRDNLISDGVLIYKLLIGREV

Enzyme Prediction     

No EC number prediction in MGYG000004899_01212.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03590	PseG	2.10e-41	3	263	1	273	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
COG3980	SpsG	1.56e-25	3	262	2	258	Spore coat polysaccharide biosynthesis protein SpsG, predicted glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam13302	Acetyltransf_3	2.76e-12	322	450	4	138	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.
COG1670	RimL	3.37e-08	321	468	11	178	Protein N-acetyltransferase, RimJ/RimL family [Translation, ribosomal structure and biogenesis, Posttranslational modification, protein turnover, chaperones].
pfam00583	Acetyltransf_1	4.34e-05	354	450	21	116	Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT36299.1	1.51e-301	1	473	1	473
QBJ19933.1	1.01e-154	1	326	9	335
QUT67638.1	2.45e-146	1	317	9	325
QRM70471.1	1.41e-112	1	450	1	464
QUT98892.1	1.59e-104	1	316	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HBM_A	9.54e-17	3	262	2	256	ChainA, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819],3HBN_A Chain A, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58462	8.07e-18	3	450	2	467	Uncharacterized protein MJ1062 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1062 PE=1 SV=1
A1W0U6	1.02e-16	3	262	2	256	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) OX=354242 GN=pseG PE=3 SV=1
Q0P8U5	1.02e-16	3	262	2	256	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pseG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_01212.