CAZyme Information: MGYG000004899_01509

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_01509
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000004899_6|CGC7	63917.68	7.181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 212482; End: 214203 Strand: +

Full Sequence      

MKKLKLILVTILAVLAANGSAKSKESAAKPFGSKVIVAYVTSWSDVMPEPQYMTHINYAF
GHVNDTFNGVRIDNEARLKQIVALKKQKTGLHVLLSIGGWGSGRFSEMAASDENRMAFAK
DCERVVKEFGLDGIDIDWEYPTSSVAKISSSPDDTKNFTLLMRDIRAAIGNKKELTLATA
ASAQYIDFKAILPYIDFVNIMAYDMANAPKHHSALYPSANSGEITSDQAVNAHLKAGVPP
SKLVMGMPFYGRGGANYPSFQDYNKVGNTNKDFTEKWDDVAQVPYLANKNDTLVFGFENP
RSLAIKCQYILNRDLLGGMYWDYSGDNEKGDLRRTVAEGLLGKPNQTKVLVLTERGGQHG
GFTDAGMKWLTDEGAKHNFSITEINNATPITEAYLSQFSLIIQLDFPPYTWPKEAENAFI
NYIEKGKGGWIGFHHATLLGEFDGYQMWPWFSDFMGGIRFKGYIAPLADGTVIIENKKHP
VMKGVPASFVVPDDEWYTYDKSPRPHVQVLAVVDESTYTPASDIKMGDHPVVWVNKDKKA
RNVYFQMGHSSRLYDTEGFTTMFRNAINWTLGR

Enzyme Prediction     

No EC number prediction in MGYG000004899_01509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	34	332	6.6e-74	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	3.41e-105	36	326	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	3.73e-80	35	326	1	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	2.83e-77	35	326	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	9.64e-72	36	325	1	345	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
pfam06283	ThuA	5.53e-67	348	570	1	213	Trehalose utilisation. This family consists of several bacterial ThuA like proteins. ThuA appears to be involved in utilisation of trehalose. The thuA and thuB genes form part of the trehalose/sucrose transport operon thuEFGKAB, which is located on the pSymB megaplasmid. The thuA and thuB genes are induced in vitro by trehalose but not by sucrose and the extent of its induction depends on the concentration of trehalose available in the medium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI79098.1	0.0	1	573	1	574
QPH57945.1	0.0	1	573	1	574
QQA31016.1	0.0	1	573	1	574
QUT64703.1	0.0	1	573	1	574
QUU00240.1	0.0	1	573	1	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	2.95e-53	49	326	23	329	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
3QOK_A	1.88e-52	12	340	7	416	ChainA, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
6TSB_AAA	1.99e-49	25	340	27	350	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
4NZC_A	2.16e-49	53	340	34	396	Crystalstructure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]
6HM1_A	2.26e-49	53	340	31	393	Structuraland thermodynamic signatures of ligand binding to an enigmatic chitinase-D from Serratia proteamaculans [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	5.68e-38	78	329	142	441	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q1E3R8	1.84e-34	54	342	65	400	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
P0CB51	1.84e-34	54	342	65	400	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
C5P230	2.51e-34	54	342	65	400	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
P48827	3.21e-34	54	351	85	408	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000695	0.832396	0.166078	0.000283	0.000274	0.000236

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_01509.