CAZyme Information: MGYG000004899_01667

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_01667
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		43421.48	8.3884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 139517; End: 140665 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASHLMAALKEEDPQAEFRFFGGDLMAAVGGTMVKHYKELAYMGFI
PVLLHLRTIFANMKRCKEDIVAWQPDVLILVDYPGFNLSIAKYIHARTKIPVYYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVEFFEGKHHYPIHYVGNPTMDEVTAFCASHSETFK
EFVESNGLSAKPIIALLAGSRKQEIKDNLPDMLRAASTFTDYQLVLAGAPGISPDYYNQY
IGEAKVKIIFGQTFALLQQAKAALVTSGTATLETALFRVPQAVCYHTPIGKVIAFLKRHI
LSVKYISLVNLIANREVVKELVADTMTVEQVRAELNRILYNKEYRQQMLDGYQYMASRLG
EAGAPKHAARKMIDLLNERCRE

Enzyme Prediction     

No EC number prediction in MGYG000004899_01667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	5.2e-113	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.96e-105	1	381	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.14e-92	1	378	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.37e-74	4	371	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.58e-61	5	375	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.64e-44	1	329	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61154.1	7.20e-247	1	377	1	377
QUT60955.1	2.62e-246	1	379	1	379
QQA29481.1	2.62e-246	1	379	1	379
QUT34964.1	3.72e-246	1	379	1	379
QUT93317.1	8.39e-246	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.22e-34	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.39e-33	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.60e-65	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	1.92e-60	5	376	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q2LVL8	5.37e-59	5	378	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.15e-57	2	378	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	6.45e-57	2	379	8	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000097	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_01667.