CAZyme Information: MGYG000004899_03322

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_03322
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		43192.42	5.5656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 81446; End: 82582 Strand: -

Full Sequence      

MIKTAFIGVGYRGKQLLKLLQHLPAFRVVAFADPGVENSDMPGVFCYNRGEDDYLNMLEE
HTPDLVFVASPWQCHVQHALQCVARGCHVALEIKGGLYLEEYQPLIQVAEQQGCHVYPLE
NTLFMRENLSLYNLIKAGVMGDIVYMRGGYRHDLRHLLLDDVGHIGNRRKTESVWRSKFY
QEENGDLYPTHGLAPLCMMIGINRKDRIKYLTSSASKPAGMLQRIKDLGGNTDVEIKMGD
VVVTQLETENGVLISLTHDTTLPRPRSLDFEIQGTKGIWQGDRRMIYIEGVSPDETWEPD
EAYVERYEHPYWQKWGEEALQIDTHHKGMDYIMLKAVETDLKDEIPYPATIQDLALWTSV
TPLSKISIAERRTINVIE

Enzyme Prediction     

No EC number prediction in MGYG000004899_03322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	372	5.4e-114	0.9448621553884712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	7.55e-19	1	378	3	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.21e-12	2	116	1	116	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
pfam03447	NAD_binding_3	0.010	26	117	22	114	Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	5.45e-234	1	375	9	383
QUT33801.1	3.27e-229	2	375	4	377
QQA30653.1	3.27e-229	2	375	4	377
QUT62197.1	3.27e-229	2	375	4	377
QRO24037.1	3.60e-158	2	374	4	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.62e-87	2	377	21	423	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.49e-45	2	370	43	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3MOI_A	1.04e-07	2	116	3	118	Thecrystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	8.88e-87	2	377	21	423	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.24e-72	2	369	34	425	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	1.11e-69	2	369	50	441	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	9.04e-69	1	369	52	443	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4FN60	8.88e-57	2	368	61	429	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_03322.